SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|115971|estExt_fgenesh1_pg.C_150221 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|115971|estExt_fgenesh1_pg.C_150221
Domain Number 1 Region: 13-176
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.18e-52
Family G proteins 0.000000665
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|115971|estExt_fgenesh1_pg.C_150221
Sequence length 183
Sequence
MGLLNLLRKLKKDDSEARILVLGLDNGGKTTILKKLSEEDISHIMPTQGFNVKSLQVDGF
KLNMWDIGGQKTIRPYWRNYYEQTDALIYVIDSADRRRLEETGMELVTLLEEEKLSNVPI
LVFANKQDLLNALPSGEISTALNLATIRDRTWHIQACSAKTGEGLQEGMEWIVNTMSTGR
EAK
Download sequence
Identical sequences A0A225VQ36 G5A1F6 H3G9T0
XP_009533500.1.77131 164328.JGI71819 67593.JGI108576 jgi|Phyra1_1|71819|fgenesh1_pm.C_scaffold_51000002 jgi|PhycaF7|115971|estExt_fgenesh1_pg.C_150221 jgi|Physo1_1|108576|estExt_fgenesh1_pm.C_160015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]