SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|116872|estExt_fgenesh1_pg.C_190171 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|116872|estExt_fgenesh1_pg.C_190171
Domain Number 1 Region: 425-747
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 5.76e-86
Family Phosphotransacetylase 0.000000542
Further Details:      
 
Domain Number 2 Region: 54-262
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000015
Family Nitrogenase iron protein-like 0.038
Further Details:      
 
Domain Number 3 Region: 253-374
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.00000000000000243
Family DRTGG domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|116872|estExt_fgenesh1_pg.C_190171
Sequence length 786
Sequence
MWTLRRSLRRSALGMAKAHSRALTAAAMSQGKVPIENLYVTSTEVTKKTAPVLIGLAHVL
EQKFTRVGYFRPIQPSKDSSMADHHVDVMKKQLELGQDVEQLYGVTSTRAMEAMLTGKGD
DIVEEILERYEECRKGHDFMIIEGSQISKHESAMSWKINVDIAKAIGSPVLMVTDFGESS
AENGELLEEMISRTVMGKDQADAAGLNYLGTIANRVRAKDADSLRAELKKKLGEKEIPFL
GFLPMDEIIASKRLNEVTHQLGATQLFGNSIANDAVVTSAVVAASALKDLFAHLKKYKDG
AMIITSGDRSDLMLGLMVSRLPGVLPNISAIVLTNGNYPHSNTQEILKGVEALDKTALSL
PIFSTPNDTFSTADGFAKVSTDILPTSKLKIDRSKQLFDEFVEKEMLIGELDEGMVVNRS
PKQFQHFLFSKSRAVQRHIVLTEGEDIRVLQAADQILRQNLSKITILGDPDEILLNAKTI
NLDLSRANIVRPSDSDLLEQYVDYFYEKRKHKGVTRELARDYCKDETYFGTLMVELGDAD
GMVSGACHTTANTIRPALQLIKTTPNRPIVSSVFFMCLEDGVRIYGDCAVNTDPSAQDLA
QIAVTSAESAEAFGLIPKVALLSYATGDSNSGPIIDKVREATKIAQELRPDLDIYGPIQY
DAAVDESIAKTKLKAIPSGAKVGGQANVLIFPDLNTGNNTYKAVQQSTGCIAMGPMLQGL
RKPVNDLSRGATVKDIVTTVAITAIQADQVILKREAEARGRHVPYEYACCRVRVTFTTMV
SCEGST
Download sequence
Identical sequences jgi|PhycaF7|116872|estExt_fgenesh1_pg.C_190171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]