SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|117696|estExt_fgenesh1_pg.C_230263 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|117696|estExt_fgenesh1_pg.C_230263
Domain Number 1 Region: 237-822,852-967
Classification Level Classification E-value
Superfamily Porins 5.5e-107
Family Ligand-gated protein channel 0.0073
Further Details:      
 
Domain Number 2 Region: 62-172
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 6.68e-26
Family Tetracyclin repressor-like, C-terminal domain 0.00091
Further Details:      
 
Domain Number 3 Region: 3-48
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000498
Family Tetracyclin repressor-like, N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|117696|estExt_fgenesh1_pg.C_230263
Sequence length 967
Sequence
MLLFWQHGYEGTSMSALVEALGIASARIYAAFGSKEQLFREAVALYEEGEGGFAPRALEQ
ATLREAIGSMLREAVMTYTRRGRPHGCLVVSSASSVSPDGEGVRDWLASHRRQRTAAIIA
RLQQAQAEGELADDAAVQALGDHFATVLHGISVQARDGISRERLLAMVDVAFPPFCRPAR
AGRSDASSEHCMPSHTDSRRLSGLSSSLVSFRRHPLALACAGLALVGSFGAAAQDSAPTP
TGLDTITVTAEHREQNLQEVPVSVGVVQGERMRDFTAGGDDTLLALSGRVPSLYAETTTG
RIFPRFYIRGLGNIDFYLGASQPVSIIQDDVVLEHVVLKSNPVFDVDQVEVLRGPQGSLF
GRNTTAGIVKFDTLKPTQDYTGRVSASYATYNSVSIDGGFGGPINDIASFRVSALYQHRD
DYVDNTYKGPSADGTVSPKKNAMGGFDDRNVRAQLLLTPSDQFSILASAHARDYEGTSTL
FLRGALTKGSNKTDVPRDKVAYDEADNNPQAYKTYGGSVKARYDFGAIDFTSITAYETTS
GYSRGDTDGGAAVNFPVNGVPNGYGQSMGRIRDLDQWTQEFRLASHDDRALQWQAGAFYF
NGSDTTDFYQRAWFLQGPARNPNNWVRLRNKNTSWAGFGQLSYAFTDKFTVTAGLRQTRD
EKHTRLLKTADTAAGVVTYKGRTDVKMSDTTPSWDLSAMYQVTPDVSVYAKVARGFRGPT
IQGRSAVFNADFTTADSETILSWEAGVKSSLWDNRLRLNATAFTYTVNDIQLNGNDSDGN
GVLFNADKAKAYGFEADMELRPIPNLTLSAGLSLLHSEIKDKRVYAQVCGLNGQVVCTVN
DPTIKVGANTFAQIDGNPLPNAPKYNVNLAARYDFPVSDAGTMFVSTDWNKQGYTSFVLY
DSKEFNSKGDFEGGLKIGYSGNYGAYEVALFARNITNEKNLKGVIENYMAAVYNEPRTVG
VSLNMNW
Download sequence
Identical sequences jgi|PhycaF7|117696|estExt_fgenesh1_pg.C_230263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]