SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|117924|estExt_fgenesh1_pg.C_7070005 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|117924|estExt_fgenesh1_pg.C_7070005
Domain Number 1 Region: 16-155
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0000000000000398
Family Tail specific protease, catalytic domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|117924|estExt_fgenesh1_pg.C_7070005
Sequence length 199
Sequence
MLKEERKRPCGLAPSSGGSHVAALTVASFFASENKAALAFSTDEKLPGASSRFSKRKKYY
IPYTSRCTRYRGPLAVLQSQYTRGTAELLCLSLMKRPLTSRIGATTAGSLSPTRQLRLPN
YWTVEIPHQRIFSADNELFEGVGIPATEVVPDMEVFSAQMNGNSPKKPRTAAAASSAAFD
PCVRKAIDHIMDVEAALDK
Download sequence
Identical sequences jgi|PhycaF7|117924|estExt_fgenesh1_pg.C_7070005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]