SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|118683|estExt_fgenesh1_pg.C_2630005 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|118683|estExt_fgenesh1_pg.C_2630005
Domain Number 1 Region: 1210-1263,1315-1391,1560-1651
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.52e-35
Family FabD-like 0.0014
Further Details:      
 
Domain Number 2 Region: 3142-3210,3290-3427
Classification Level Classification E-value
Superfamily Thiolase-like 1.84e-34
Family Thiolase-related 0.0045
Further Details:      
 
Domain Number 3 Region: 2807-2859,2969-3181
Classification Level Classification E-value
Superfamily Thiolase-like 9.1e-30
Family Thiolase-related 0.0026
Further Details:      
 
Domain Number 4 Region: 3569-3695
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 2.88e-19
Family Holo-(acyl carrier protein) synthase ACPS 0.0059
Further Details:      
 
Domain Number 5 Region: 1095-1205
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 4.67e-17
Family MaoC-like 0.01
Further Details:      
 
Domain Number 6 Region: 2451-2663
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8.46e-17
Family Tyrosine-dependent oxidoreductases 0.028
Further Details:      
 
Domain Number 7 Region: 113-359
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 0.00000000549
Family Inosine monophosphate dehydrogenase (IMPDH) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|118683|estExt_fgenesh1_pg.C_2630005
Sequence length 3722
Sequence
MQLLQLVDWTATWAKIAEHHANATHILEFGPDLGVAKLSNKVAEGLGMEVVIATAKHPVM
STSVKNAPLVGLQQFIDGASTFTPVEATWAKKFGPQVTESGKLFNRFTLALNKPPVMVAG
MTPTTSLEGIDLVAAVQNAGFHGELAAGGLSRPNIFEDAVNKLVSKIKPGLGIAINMLYL
NAKQWGFQFPMVLRMRRSGVPIESITIGAGIPTMERAQEMMSQLESVGIKVVCFKPGSVD
GIHAVLEIATAMPSMTVMMQWTGGRAGGHHSFEDFHQPMEETYAAIRRVPNVLLVVGSGF
GNWEDSKQYLTGEWSLARGHLYKMPADGILMGSRVMVAKEAATAPEVKKLLVDTPGIESE
LEWETSYTGTVGGVVTVTSELGEPIHVVANRGALLWKEFDEKYFSIPREQVELALRLNKK
DIITRLNADFQKPYFGCKRNVETGESVPADLEEMSYADVLTRLIDLTYVEIEGKPTRWVH
DTYFSRVSKFITRTEERFRRESSGDLFDQSDLKANPRGTVSAFIAKYPQTVSTLLSVPDC
DFFLDLCRTGGKPVNFVPAIDTEFKTWFKKDSLWYSEDLDAVPGHDAQRVFILQGPVAVR
YSTIVDEPVADILNGVATGFANVVKENGAVAVVATAPVKQTVAVEGVEVTESENSVELSI
SADESVVPSATEWLDALEACVSDKDWLSALISSTDVVEEKKWLSNPVRQLLAPQAGQKYV
VDGAGIRVFDSPIDISGPVIEITKKDASISVVVNEVRPAVTGLKAGVVALEMTFQYHPEL
SCSIHAEGSGFIDKVKAFYARFWVAIEGKEEESCKAACAESVLSPFTADFSITEEDILAY
RAALGLGAEEIGAPADFSTIVSWRPLIQSVFTKEVKGNLLDLVHLKHSYKLLSSRKASAT
FLPGDDIVSTSNVGSLRIIDSGKIVHGVAIISRKTVDDQMVEVLEPLVELHSEFLIRGVF
NDFESTFSIDKSTDAFVPLRQEDVEILKTKSWLKLAAGASVDIGDHLTFELTTTKQYASI
GSLNSVEVSGTLFREEAGSNVEIGSVAFKSHDVNESPVVAFLRQVQPEDAKAGGMFANGG
SHMLEKPLEINVPTNALAYAVASRDLNPIHRSKYAAILGHLPKGKPIMHGLWTATKVRDL
VIQSFGMGFDSNVVDYDVNFDGMVYPGDKLFMQARHVGLDNGKKVLSVEVVNASGERVVS
ARAVVKQSPMAFVFTGQGSAAVGMGMDRYQESSVAREIWDRGDTHLRQTFGFSILDMVRK
NPKSITVHFGGRRGLAIRDNYMNLTCEDPMTGKMTPLLPEIDEDSESFSFSSPEGLLFAT
QFSQPALVLLEKAMFSEIEAAQLIPDDAYFAGHSLGEYAGLISFAGALTVEALMDLVFLR
GLIMQKAVKRDSEGRSDYGMVATNPTRVGPHFTEEVMYNIVDGIEAASGKLLQVVNFNIQ
DRQYVVAGENVNLETLSLALSAFKAVKSTAADEVEKVIAESLAQARARKEKCDQTGRPFT
LARGLATIPLVGIDVPFHSRELLGGVPSFRALLRTKFDPQVLERQLPLLVNRYIPNLVAT
PFSLKRSYFEEVYEATKSPYLAEVLDPMQWKLTTKAQLAHLLVVELLAYQFASPVQWIKT
QALLFSEGGVRRFVEIGPAPTLTNMALRTLQVGDFPDVPREILWYQRDREVVHFEEETSN
ISASEYARGLAAEAAAEASAAAAKAAAVSAPKVEEAPVAAAPVAAPVVVAPVQQVQAPAP
VSVSPAAEDAPVAALHVLRVLLAVRLNKDLAEIKEDTDVKTLCAGKSAVQNEILGDLEKE
FGGGVPEGAGEVPLKELASKFSSYSTLGKVTNGLINKVVASKMPGGFTMSSIKEYLGSEK
GLGAGRMESVLAHSLLLAPQARFKSDMDARKWLDDSVNGYASFAGISLARPSVSAAPGAV
GMSFNPAPVSAPTVSDQPVEAKHALLVMLAAKFGKAFSEVPETATIKELSAGKSAVQNEI
VGDLEKEFGSGPDDAAEMKLGELSGKFPGYASPGKVTSALIAKMLASKMPGGFGLSAIKE
YLSSERCLPSGRIESVLLHGLTQNPKQRLTDDATAKKWLDGVVDDYAKYAGIEIPYLSKL
GGMMAGPAMGQPAMQSSSLPSDFEKRLKSMIADQIDALNSYLGDDQLDWHRKIETEVDMR
EDLESSVSQWVTEHGEFYGAGIAAKFDSKKERQYDSYWNWAVQDAMELYYRTATAGKSLK
LAANESFITHLCNRSTPELVCCMKRLVLRAEDDNNQELAKELKTIVVHMEERQSKKPVSV
QSFEPSKPHLCILENGKLEYAEVVREGVVNAIDYVEDVARGLEYNGLVNSKKFGNLMVKK
NTGTDPNPTDNDSTTSEDMDSNGIDSSDEESAVHRTTESARLETIDDVLRAQQKPESTPV
VHSSLLHSRMNETLKTTALPHVHVRKPSGVDPTIRLYDVESTCVLLSCMREMASTGISFA
GKVALLTGCGKNSIGAEIVKALLEGGATVFVTTSSFSMETTSLFREIYEQHGSRGSRLIV
LPFNQASKVDVQNLVAHIYNVHKLDLDFVIPFAALSEVGRTITDIDSRSELAHRIMLTNT
MRLLGEVVTAKKARDITTRPALVILPMSPNHGNFGGDGLYAESKLGVESLMGKWYSEGWD
DQLSVVGAIIGWTRGTGLMSGNNVVAAGVEKMGMRTFSTTEMGFNLSALMHPSIVDRAAE
SPIFADLSGGMAQVSDLKDQVDIIRADIMKKAKLQASIHAALENDKKMLALPSKNQSSGT
NPKAFAPRANMSSYYCNSFPKLSNVAGLSATTKQAMLRGMLDLRQVVVVTGFGEVSPWGN
SRTRWEMESYGEFSLEGCIELAWLTGRIVFDKGNWVDAKTKEIVPDHQVKPRYEEDILKH
SGIRIVEPELFNGYDPKNKMVLHQVAIDKKMSPIEVADREEALQFRKELGKENVDVFQNA
SGAWMIRLRKGSVLNIPRALNFDRFVAGQIPTGWSAERLGLSKDLAESVDPITLYVLAST
MDAFVAAGVTDPYEFYQYVHVSEVGNTSGGGMGGMRAFTQIYKDRLLGKPAPSDALQECF
INTPPAWVNMLLLSSSGPIKTPVGACATAAESVDIGAETIKSGKARICIVGGYDDFGEEG
ANEFAQMKATSDSVKEAGMGREPKEMCRPCSTTRGGFMESHGAGIQLLMDAQLALEMGLP
IYGIVALTNTATDKNGRSVPAPGQGILTTAREASSDNSKPSPLLDVEFRRRQFDDELKSI
EKWYAREKALIDGDESRVAFLDEMKLRKVQAAQAMWGDNFFHSRTDIAPLRGALSVWNLN
IDDVGAASFHGTGTKANDKNESEVTHKQMAHLGRSPGNPLPVICQKNLTGHPKGAAAAWM
LNGLLQVLNTGLIPGNRQLDNTCETLRKYDHLVYPNRSFQTVGVKAVMMKSFGFGQAGGE
VLLVHPDYLLSTLPAEEFQHYSARREQRLIKMNTHTQGVLTGKQAHIQVKNEAPYSSAQE
SNVYLDPTARAEYDATSKTWRFGGADSLTAEENRRLRAEKRAKKAKAAAEAAAASSKKTS
DVHQADSSSTLLTAINQAATDLGLASKNMGMGVDVEPVATFENLNGREDFIRRNFTDQEM
AYCYSAPHPAASFAGRWAAKEAVIKAISSSSPTEPNLWKGAGAPLREIEIFMTASGAPSV
LLSGYPLQVFNRLGLSKLSVSISHSGDFAVSQAVANFQQDVAFLEERNTREISDPPFARG
SG
Download sequence
Identical sequences jgi|PhycaF7|118683|estExt_fgenesh1_pg.C_2630005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]