SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|123193|estExt_fgenesh1_pm.C_190114 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|123193|estExt_fgenesh1_pm.C_190114
Domain Number 1 Region: 88-155,270-461
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.95e-25
Family Tail specific protease, catalytic domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|123193|estExt_fgenesh1_pm.C_190114
Sequence length 505
Sequence
MLAVTRKIWALLPLRLNWLTPDALLQLLILWPLELYEAVAILPVSFLRRHVPVLGGALVV
LMTLHGILLRLFLELLRAIFARVTYSRDPVLTFRSFWRAMQDHYAFLEPRRVDWQLVRQL
FGDAIQPATSDDDLWIALQESVSLCDDPSLTVSRVAGPAGSSGPRTLTVRGHKLPTAAAL
KFQQYTLAAIEREHLTQGGRRIANDRFVCGILNAETCPGWRIGYICLTAMQGFVEFPLPR
VDALMPSWTRGASTANISGEGAGQTLLDVDGKAGEGRGSLAGSSVAVPEIYDLESMRWSL
EAILLGLGDMDGLILDLRFNQGGGSHVAALTVASFFASENKAALAFSTDEKLPGASSRFS
KRKKYYIPYTSRCTRYRGPLAVLQSQYTRGTAELLCLSLMKRPLTSRIGATTAGSLSPTR
QLRLPNYWTVEIPHQRIFSADNELFEGVGIPATEVVPDMEVFSAQMNGNSPKKPRAAAAA
SSAAFDPCVRKAIDHIMDVEAALDK
Download sequence
Identical sequences jgi|PhycaF7|123193|estExt_fgenesh1_pm.C_190114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]