SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|14812|gw1.5.411.1 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|14812|gw1.5.411.1
Domain Number 1 Region: 225-313
Classification Level Classification E-value
Superfamily GroEL apical domain-like 0.00000654
Family Group II chaperonin (CCT, TRIC), apical domain 0.0024
Further Details:      
 
Weak hits

Sequence:  jgi|PhycaF7|14812|gw1.5.411.1
Domain Number - Region: 4-116
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 0.0241
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|14812|gw1.5.411.1
Sequence length 314
Sequence
MERINRSEVKQRLGNVCRELMALVRGSYGPLGRAQLLQANAQCPDALTATSVAERYLANF
NVGDCPIANAYYHILKSKIEIQEGSLAQVPHRVVSKGLQLGLDWCLQYLEDRKCPVRTAV
NWSSPTSISAVIRSIVSSKTTTGLDGDVMDTVVIPLIIQAFVSVFGYVVQNPSESVPVQL
LFAPGQRSVAKSEVWKQTVLLDLPWPTRCRPQRTKKDPLSPPLCNLRVALFNITIEPLAE
YEEEEVNSAVTVNHSGSLAAFRLKALRQVGDRLQELGATAVLSQKIIPKYLQTYLASKGI
FTLDRLSATYIRKL
Download sequence
Identical sequences jgi|PhycaF7|14812|gw1.5.411.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]