SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|20075|e_gw1.7.292.1 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|20075|e_gw1.7.292.1
Domain Number 1 Region: 12-288
Classification Level Classification E-value
Superfamily Thiolase-like 2.31e-56
Family Thiolase-related 0.0000553
Further Details:      
 
Domain Number 2 Region: 288-431
Classification Level Classification E-value
Superfamily Thiolase-like 2.06e-30
Family Thiolase-related 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|20075|e_gw1.7.292.1
Sequence length 431
Sequence
MPGISMPNARPVAILGGVRIPFCRQNTAYSDVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSSDWNLGREATLSSGLSPLTPGITLQRACGTSLDSIITVANKIALGQIESGIG
GGSDTTSDVPIVYGKKLRARLLAANRAKSTGDKIRALTAGFKFSELKPEFPGVAEPRTGK
SMGDHCEDMAKEWNISRDSQDEWAVSSHKKLAAAYERGFFNDLIAPFRGVERDNILRPDT
SLEKLATLKPAFDKVSGRGTLTAANSTPLTDGAAAVLLASEEWARAHGHEPQAYLRDAHV
SAVDFVHGEGLLMAPTVAVPEMLKRNGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPMGRIDPDKINLLGSSLATGHPFAATGARVIATAAKQLAERGGGRALVSICTA
GGMGVVAIVER
Download sequence
Identical sequences A0A1Z2LER3 A0A2H5IBT4
WP_029550824.1.14841 WP_029550824.1.25227 WP_029550824.1.57231 jgi|PhycaF7|20075|e_gw1.7.292.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]