SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|28114|estExt_Genewise1.C_00042 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|PhycaF7|28114|estExt_Genewise1.C_00042
Domain Number - Region: 411-454
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0534
Family Tetracyclin repressor-like, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|28114|estExt_Genewise1.C_00042
Sequence length 892
Sequence
MSSDRQAARMKRRAERLGPPSRAHSSSVGSSRHSYAVSTDTSASRTRGSSLPSDSDSLRR
PPTHGSSSATSVAMSTRRGSSARSPRDINVLVDKLLAKVHGAPSAITTRRTVVRLHDAAS
GGPTDAFSVLEKIKRKVTADTQLYGNAQETITRLNEVYSRFVKFKNLDKKTEALVLLYGL
MDTVPPPRSEEEATRVDVAAMEMNNSPARGSISGSVESSVSEGNGNVAAHHRSQSMPAVS
ESFTGQNAVEHPKTDLDSLEDSFKFAVGIAPTHKTSRGKGSPRTHSAVTASGTVSAVAGR
ASFDVPEEVLLRDVLYALQAIESRYLYFDDAADRFQITRSVGVPTPMRELIHMLCDLGWI
YRKISEYIKQHREELAFGLEPLDRMRLMARLIDSVDGLRGGALASGVYSHVLHGDPEVSK
FVEKVLKQIAAPIVRMIKRWVFEGELEDVHGEFFVVADSTVSDDQFWAKKYTLNLKMLPR
FISIELAKKILVIGKSINFIRQCCGNADWVMDAGQETAVIGMETDNEGAYFAELKRLEKV
IENVSNSTNEYLIRTLTEKYRLLDHCQALKRYLLLGQGDFIQYLMDLLGPELSKRGSQVY
RHTLTNVLETALNASNAKFEVSDTGWDIFCLHYNLQAPVNSVIPASSMLQYQQIFDFLWR
MKRVEHSLSASWTKDMNLGHEVQGCVPGIRPVLHRSQLVRSEMIHFTTNLLNYMMFEVLE
TAWHQLVKDLNAAKDLDGLIESHAAYIASVKKNGFMMKESGGLLKQLKLIFATIIRFCKA
QENLYTTAMHEKHVEERRQQLIQRQELDGSWGIPEEEGYSTRSDRDIFGTNSKILRQIEE
ISEDFSNQFLELLEIVKQNSIRGSQSLSFLMSRFDFNEFYLKKTAPPMEADE
Download sequence
Identical sequences jgi|PhycaF7|28114|estExt_Genewise1.C_00042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]