SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|31021|estExt_Genewise1.C_200066 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|31021|estExt_Genewise1.C_200066
Domain Number 1 Region: 34-242,316-412
Classification Level Classification E-value
Superfamily ClpP/crotonase 9.8e-66
Family Crotonase-like 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|31021|estExt_Genewise1.C_200066
Sequence length 429
Sequence
MQRVMAMRLRLLQRPMRVAASGNRSAAFSTKTPEFTDIVYGQDTGVRTVQFNRPTKLNAL
TLPMAQHLTQRLHKIEANKTVNAVVFSGNGGKAFCAGGDIRALADNGKDPATRYLSLDFF
RHEYRLNYLLATTEKPIISFLNGVTMGGGVGLSMHGKFVVATEKTLFAMPETAIGFFPDV
GASYLLPRLGRRLIEGEDYVQDVPKSQALKGQGLGTYLALTGERLKGHEVIGLGLATHYL
PTSEYETLVHHLTGLEFEDHVSQEERDEIIHEALEELETDEAFQEVDPEYLETVESVFGA
LNENDTVEGIFERLEKLNTEWSQETLATLKKMSPLSLKVTLEQMRQGAVKTCAECFQMEY
RMATRMMENPDFFEGVRSVVVDKDRNPKWAKRDITKVTTKEVKAFFKPLDKDQELILYPS
ATAVTEKEE
Download sequence
Identical sequences jgi|PhycaF7|31021|estExt_Genewise1.C_200066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]