SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|31505|estExt_Genewise1.C_10140001 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|31505|estExt_Genewise1.C_10140001
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.98e-40
Family Tandem AAA-ATPase domain 0.0000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|31505|estExt_Genewise1.C_10140001
Sequence length 221
Sequence
MIKNRACQYLLFSATYADDVRDFAQKMVPDHNIITVKKEKLTLDGIKQFWIDCKTRDNKF
QVLSDIFAILTIGKCVIFVQQRETAKELTRRMREKGHSVGILHGADMAKEVRDQVIDEFR
AGTTNVLITTNVLARGIDVAGVSLVVNFDIPLTRDHRPDPETYLHRIGRTGRFGRKGCAI
NFVYDNKSKQDLAEIEEYYARPITQAPADDIEELEKMLAWE
Download sequence
Identical sequences jgi|PhycaF7|31505|estExt_Genewise1.C_10140001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]