SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|33544|estExt_Genewise1Plus.C_00442 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|33544|estExt_Genewise1Plus.C_00442
Domain Number 1 Region: 12-264
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.37e-73
Family Crotonase-like 0.0000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|33544|estExt_Genewise1Plus.C_00442
Sequence length 265
Sequence
MKDWRTQEHVGLKVEADGHTAVVTLSNPPAHTWTVHSLSALRDLVGALNADRDVYALVIT
GDGEKFFSAGADLNQFASGDKAAAREAARRFGEAFEALSGFRGVSIAAINGYAMGGGLEC
ALACDLRIIEDHAQVALPEATVGLLPCAGGTQNLPRLVGEGWAKRMILLGERITAETALR
IGLAEEKVGKGEAKALALEWAKKAGKQSPTSIAACKTLVQSTRTGTHASALVAEREAFVD
LFDTADQVEGVTAFLEKRTAQWKNA
Download sequence
Identical sequences jgi|PhycaF7|33544|estExt_Genewise1Plus.C_00442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]