SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|36319|estExt_Genewise1Plus.C_120142 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|36319|estExt_Genewise1Plus.C_120142
Domain Number 1 Region: 14-143,405-523
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 3.79e-83
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00014
Further Details:      
 
Domain Number 2 Region: 211-378
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.67e-54
Family Group II chaperonin (CCT, TRIC), apical domain 0.000000624
Further Details:      
 
Domain Number 3 Region: 143-215,369-404
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 3.36e-24
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|36319|estExt_Genewise1Plus.C_120142
Sequence length 530
Sequence
MMQAPVMVLNTNTKRETGRTAQLGNIEAAKAVSDIVRTTLGPRSMLKMLLDPMGGIVMTN
DGNAILREVDVAHPAAKSMIELSRAQDEEVGDGTTSVIILAGELLVVAEPFLSHQVHPTV
IIRGFNRALNASLEIAKKLARTIDIENKEDMRNLVQSSIGTKFSPRVGNLVSDLALDAVL
TVVRTSASGRKEVDVKRYAKVEKIPGGELEDSRVLKGVMFNKDVTHSKMRRRIENPRVLL
LDCPLEYKKGESQTNVELTNDQDWNTLLRLEEEYIENLCAQVVAMKPDVVITEKGVSDLA
QHYFVKAGITAFRRLRKTDNNRVARATGATIVSRADEIQESDIGTKCGLFEVRKLGDEYF
AFFEECKDPGACSILLRGGSKDVLNEIERNLQDAMQVARNVVFEPLLLPGGGATEMRLAH
ELKKRADEIEGVEQFPFRAVGEALEVIPRTLLQNCGADVVRVMTSLRAKQAETEESYGVD
GVTGKVTASEELGVWEPFQVKTQSIKTAVEAACMLLRIDDIVSGLAKKKN
Download sequence
Identical sequences jgi|PhycaF7|36319|estExt_Genewise1Plus.C_120142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]