SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|36809|estExt_Genewise1Plus.C_610007 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|36809|estExt_Genewise1Plus.C_610007
Domain Number 1 Region: 17-200
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.97e-73
Family Clp protease, ClpP subunit 0.000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|36809|estExt_Genewise1Plus.C_610007
Sequence length 208
Sequence
MDNRTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVVVAQLLFLES
ENPEKDINIYINSPGGVVTAGMAIYDTMQYIKPNVSTTCIGQAASMGALLLAAGEAGKRY
ALPNSRVMIHQPLGGYQGQATDIDIHAREILTLRSRLNEVLAKHTGQSLETIARDTERDN
FKSAFEAQAYGLVDQVLERRPDESIQAG
Download sequence
Identical sequences A0A0G5Z6V6 A0A0J8PPJ7 A0A0L8AA82 A0A149QAZ0 A0A1Z2LGW7 A0A239Q8G4 B2FQR2 B4SLN1 G0JZS4 J7V5V9 M5CJQ5 M5CU60
gi|344206260|ref|YP_004791401.1| WP_004146318.1.100705 WP_004146318.1.100833 WP_004146318.1.10738 WP_004146318.1.11095 WP_004146318.1.1211 WP_004146318.1.12365 WP_004146318.1.12888 WP_004146318.1.1479 WP_004146318.1.14841 WP_004146318.1.16072 WP_004146318.1.16506 WP_004146318.1.16596 WP_004146318.1.1777 WP_004146318.1.22973 WP_004146318.1.2335 WP_004146318.1.2396 WP_004146318.1.25227 WP_004146318.1.25576 WP_004146318.1.27790 WP_004146318.1.28611 WP_004146318.1.29369 WP_004146318.1.31544 WP_004146318.1.3235 WP_004146318.1.3261 WP_004146318.1.34786 WP_004146318.1.35772 WP_004146318.1.36201 WP_004146318.1.36422 WP_004146318.1.37169 WP_004146318.1.37822 WP_004146318.1.39469 WP_004146318.1.40955 WP_004146318.1.41077 WP_004146318.1.41422 WP_004146318.1.42020 WP_004146318.1.42380 WP_004146318.1.42768 WP_004146318.1.44206 WP_004146318.1.45403 WP_004146318.1.46408 WP_004146318.1.46974 WP_004146318.1.47391 WP_004146318.1.480 WP_004146318.1.48568 WP_004146318.1.48875 WP_004146318.1.4992 WP_004146318.1.51731 WP_004146318.1.52013 WP_004146318.1.52370 WP_004146318.1.52398 WP_004146318.1.53081 WP_004146318.1.53173 WP_004146318.1.53851 WP_004146318.1.56449 WP_004146318.1.5674 WP_004146318.1.57231 WP_004146318.1.57672 WP_004146318.1.6040 WP_004146318.1.60890 WP_004146318.1.61049 WP_004146318.1.61625 WP_004146318.1.6195 WP_004146318.1.6217 WP_004146318.1.62189 WP_004146318.1.63090 WP_004146318.1.63410 WP_004146318.1.63809 WP_004146318.1.65088 WP_004146318.1.65590 WP_004146318.1.65951 WP_004146318.1.70371 WP_004146318.1.71426 WP_004146318.1.72571 WP_004146318.1.73044 WP_004146318.1.73231 WP_004146318.1.7336 WP_004146318.1.7647 WP_004146318.1.77447 WP_004146318.1.78518 WP_004146318.1.79657 WP_004146318.1.79838 WP_004146318.1.80113 WP_004146318.1.81009 WP_004146318.1.82179 WP_004146318.1.83038 WP_004146318.1.83699 WP_004146318.1.85246 WP_004146318.1.8701 WP_004146318.1.88566 WP_004146318.1.89109 WP_004146318.1.89178 WP_004146318.1.91578 WP_004146318.1.9200 WP_004146318.1.92472 WP_004146318.1.96337 WP_004146318.1.96606 WP_004146318.1.96643 WP_004146318.1.98612 WP_004146318.1.98615 jgi|PhycaF7|36809|estExt_Genewise1Plus.C_610007 391008.Smal_0836 522373.Smlt0989 gi|194364614|ref|YP_002027224.1| gi|190573022|ref|YP_001970867.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]