SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|36837|estExt_Genewise1Plus.C_150011 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|36837|estExt_Genewise1Plus.C_150011
Domain Number 1 Region: 6-225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.58e-30
Family Nitrogenase iron protein-like 0.029
Further Details:      
 
Domain Number 2 Region: 249-350
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.00000129
Family HPr kinase/phoshatase HprK N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|36837|estExt_Genewise1Plus.C_150011
Sequence length 379
Sequence
MSPKAAVYVAATRQHVGKTSTCIGLLQGLTSRLDRIGFLKPVGQESVAVEGGSLRVDKDV
AVAKEVFKLDTCNYADMSPVVIMPGYTKRFLDGHITVQSQLDKIHTSFKRISAANEFTVV
EGTGHTGVGSIVDCNNARIAAELGVDMVLVANGGLGSAFDDLALNYSMCKAHNVNVRGVI
LNKVREDRVDMVREYFPKAMKQWGDNIPLIGVVPNLPALSNPSMLDFEGLFSTQMLTSRS
RRFQQYTKTTLVTAGLRRFLAKLTDPEFDHSLFVTHVSRNDIILGFLSHAQNFELTTKRP
YGGGLILTGSPSDDQPQEYITNIVKNAHTPVLYVPITTFEAMEKITHFTAKFNPTDEQKV
HACGEHYANHIDFNAILAR
Download sequence
Identical sequences jgi|PhycaF7|36837|estExt_Genewise1Plus.C_150011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]