SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|37913|estExt_Genewise1Plus.C_200064 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|37913|estExt_Genewise1Plus.C_200064
Domain Number 1 Region: 288-542
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.42e-86
Family Biotin dependent carboxylase carboxyltransferase domain 0.000000142
Further Details:      
 
Domain Number 2 Region: 43-291
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.06e-75
Family Biotin dependent carboxylase carboxyltransferase domain 0.000000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|37913|estExt_Genewise1Plus.C_200064
Sequence length 542
Sequence
MLAARQLRVLRQPLLQSRWMSALVDEAASPILTPAARKLAFKDELEQARKRALEGGGANR
VAKQHEKGKLTARERIELLLDKGSFREYDMLKSHRCSDFGMEKQQYPGDGVVTGRGLING
RLTFVFSQDFTVFGGSLSETYAEKIVKIMNKAMELGAPVIGLNDSGGARIQEGVASLAGY
ADIFQLNVLASGVIPQLTMVMGPCAGGAVYSPAMTDYIFMCRDSSYMFVTGPDVVKTVTN
EEVTQEELGGAATHTKTSGVAHCAFDNDVEGIRELRRFFDFLPLNNKEKPPVRKSDDDRN
RPVPTLESIVPPDPNVPYNMKDIIHQIVDSFDFFEIMPDYAKNIIVGFGRMEGRVVGIVA
NQPMELAGCLDINSSVKGARFVRFCDAFNIPIVTMVDVPGFLPGTDQEYGGIIRHGAKLL
YAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPSAEIAVMGAKGAVEIIFRGQ
NVEENTADYEKKFANPMVAAQRGFVDDIIEPVNTRRHICEDLDVLETKNVKNPWKKHGNI
PL
Download sequence
Identical sequences jgi|PhycaF7|37913|estExt_Genewise1Plus.C_200064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]