SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|38301|estExt_Genewise1Plus.C_220091 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|38301|estExt_Genewise1Plus.C_220091
Domain Number 1 Region: 16-84,161-292
Classification Level Classification E-value
Superfamily Thiolase-like 1.68e-32
Family Thiolase-related 0.0056
Further Details:      
 
Domain Number 2 Region: 424-543
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 8.11e-18
Family Holo-(acyl carrier protein) synthase ACPS 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|38301|estExt_Genewise1Plus.C_220091
Sequence length 545
Sequence
MKATSDSVKEIGMGREPKEMCRPCSSTLGGFMESHGAGIQLLMDAQLAIEMGLPIYGIVA
LANTATDKTGRSVPAPGQGILTTARENASTPSPLLEVAFRRRQFDDEIESIDEWFEREKN
LVEDNDVGLKLLSDMKEQKVKAAQSMWGDKFYKGRSDIAPLRGALNTWNLDIDDIGASSF
HATGTKANDKNESEVTHKQMAHLGRSPGNPLPVICQKSITGHPKGAAAAWQLNGLLQVLN
TGLIPGNRQLDNTWETLRKFNHLVYPNRSLAVLLKSFGFGQASGELLIVHPDYLLSTLCG
DDLKEYVVRRDKRLIKMNSHAQSVITSKRPHIHVKNEAPYSAAQESSVYLDPTVRAEYDP
TADTWRFGGTKRLRHRSAKRVKANVVEASVSARQNPGAHTAGSSSGLLTVMNQAASELGL
ASAVGVSVQPVDKFESLHGCEDLIQRNFTNQEMAYCYSAAHPAASFAGRWAAKEAVVKAM
TNATPKLWDGAGLREIEIVMATSGAPAVVLSGYAQQFFSECGFTRINVSISHSDHVAVAQ
AVAGF
Download sequence
Identical sequences jgi|PhycaF7|38301|estExt_Genewise1Plus.C_220091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]