SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|39043|estExt_Genewise1Plus.C_863980001 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|39043|estExt_Genewise1Plus.C_863980001
Domain Number 1 Region: 33-215
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.74e-70
Family Clp protease, ClpP subunit 0.000000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|39043|estExt_Genewise1Plus.C_863980001
Sequence length 224
Sequence
MLTRTSKLLQTAGARRGFHSIMNSLVPMVLEQSPRGERVFDIYSRLLKERIVFVHGPVHD
DMASLVTAQLLFLESENPEKDIYMYINSPGGIVSSGLAIYDTMQYIQPKVNTLCMGQAAS
MGSLLLAGGAPGCRSALPNARIMIHQPSGGAQGMASDIAIQAEEIIKLRARLNGLYASHT
GKPIKVIEQAMDRDLFMDPREAQEFGIIDSIIANRKPTQSSTEQ
Download sequence
Identical sequences jgi|PhycaF7|39043|estExt_Genewise1Plus.C_863980001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]