SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|66031|fgenesh1_pm.C_scaffold_2000059 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|66031|fgenesh1_pm.C_scaffold_2000059
Domain Number 1 Region: 1-269
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.58e-58
Family Crotonase-like 0.0000989
Further Details:      
 
Domain Number 2 Region: 275-452
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.91e-42
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 453-554
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.62e-23
Family HCDH C-domain-like 0.00067
Further Details:      
 
Domain Number 4 Region: 561-639
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 2.81e-17
Family HCDH C-domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|66031|fgenesh1_pm.C_scaffold_2000059
Sequence length 651
Sequence
MSQDVLLELGDLLERIALDPPKGVVIQSLKKAGFIAGADLKEFQEFDRRGTVNDAIRRGQ
ATYQKLAELPCPTVAAIHGHCLGGGTELALACRYRVASNDSSTRIGLPETQLGIFPGWGG
SARLPQLVGAPAAMDMMLTGRTLSASAARGIGLVDKVVAPAVVLDTAVALALSGTTRPFK
QRATAWATNTWLARTLLAPQMVKQVARKAKKDQYPAPYALISTWQRSGGKPIQARLDAER
RAVVKLASTPTARNLIRIFFLTERLKGLGGGDSGIRHVHVVGAGVMGGDIAAWAAYKGFE
VTLQDREQRFIDPAMERAQALFAKKVRDESKRPAVAARLRADLEGNGVAEADLVIEAIIE
NPEAKRALYQTLEPKMKLDALLTTNTSSIPLVELRDHIQRPAQFAGLHYFNPVAQMPLVE
IIHHDGMAPETERRLAAFCKALGKFPVPVAGSPGFLVNRVLFPYMLEAATAYAEGIPGPV
IDKAAVKFGMPMGPIELIDTVGLDVAAGVGRELAPFLGLQIPAALQTVEPDKRGKKDGQG
IYTWENGKPKKPDVASDYQAPADLEDRLILPLLNEAVACLHEGVVADADLLDAGVIFGTG
FAPFRGGPIQHIRAVGADAIVERLKALQQRHGDRFAPRPGWDNPALREPVV
Download sequence
Identical sequences jgi|PhycaF7|66031|fgenesh1_pm.C_scaffold_2000059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]