SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|69095|fgenesh1_pm.C_scaffold_62000001 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|69095|fgenesh1_pm.C_scaffold_62000001
Domain Number 1 Region: 7-134,360-475
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.25e-77
Family GroEL chaperone, ATPase domain 0.000000797
Further Details:      
 
Domain Number 2 Region: 184-330
Classification Level Classification E-value
Superfamily GroEL apical domain-like 7.59e-45
Family GroEL-like chaperone, apical domain 0.00000819
Further Details:      
 
Domain Number 3 Region: 138-203
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 7.55e-23
Family GroEL-like chaperone, intermediate domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|69095|fgenesh1_pm.C_scaffold_62000001
Sequence length 503
Sequence
MAAKDIRFGEDARSRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI
ELADKFENMGAQMVKEVASRTNDDAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI
DKAVVAAVAELKTISKPTADDKAIAQVGTISANSDESIGQIIADAMKEVGKEGVITVEEG
SGLDNELDVVKGMQFDRGYLSPYFINNQQSQTADLDDPYILLHDKKISNVRDLLPVLEGV
AKAGKLRRPSQGDAGRHGLGLSLEKATIKDLGRAKKVQVSKENTTIIDGVGDKAAVDARV
GQIKTQIQDTSSDYDREKLQERVAKLAGGVAVIKVGASTEIEMKEKKDRVDDALHATRAA
VEEGVVPGGGVALVRAVTALAGLKGANEDQNHGIQIALRAMEAPLREIVANAGEEPSVII
NKVKEGTGSFGYNAATGEFGDMLQFGIMDPTKVTRSALQNAASIAGLMITTEAMVAEAPK
KDEPAMGGAGGMGGMGGMGGMDF
Download sequence
Identical sequences jgi|PhycaF7|69095|fgenesh1_pm.C_scaffold_62000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]