SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|76378|fgenesh1_pg.C_scaffold_4000002 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|76378|fgenesh1_pg.C_scaffold_4000002
Domain Number 1 Region: 664-838
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.97e-42
Family Biotin dependent carboxylase carboxyltransferase domain 0.000011
Further Details:      
 
Domain Number 2 Region: 403-648
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.51e-28
Family Biotin dependent carboxylase carboxyltransferase domain 0.00000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|76378|fgenesh1_pg.C_scaffold_4000002
Sequence length 842
Sequence
MDAIYSHLRYCAASPRGLSNPGSLRHAKFSPGIAIARPILLFHHDFNLENICTNRCTVSV
LAVAEDPEFNDSEVVEILDEHKKTLDTNRKRTSRLHANSHNNEDVVMALHQQNSSHLDKV
FSIARSHKALESKNKLLLQLLAQMARGTPRKSVNRCFRAATREARYLQRETLLIDNKMPS
YRDRLSHVAKNISAHNADMALYPNIYIFPGRLNYSEAKIVRHMEAPLAYKLELRRLQNYS
VTPLASENKNVHLYLAKMKGSVSHIVPTPSSASSCARWCASLTTTASSLPTKTNQVYLNI
LPQAIVGPQYLEGVIRILAYRYAERLEQLGVPTVELKIIARFNSEAPAIPVNPTDYVPIF
TSIGDETHGELDGMPVTKMYMIVFPFDKKRQMAKAMSNIVYVYAFLELIKYNLLHQWRKY
VQQRTHGGGAKITIPNLLMEVRELILDATGKTITETTRPRGQNDIGMVAWLLTLYTPEFP
DGRGIVIIANDITFKAGSFGTREDTLFDLASKLARSKGIPRFFFSVNAGPAQVCWKDETN
PTKGFEYLTPEDYRIASADGAVNAELLVTSTGEERYVLNDIVGREIDLGSVGIGAYLALN
KLVGKEVYTSNGQLGSVKIMHTNGVTHLTAKNHLSGIYSILEWLSFVPLVRRSPLPIRDL
TGVDAIERTVDFCPKDKSTQYDPRALLAGKVDEATGKWVSGLMNKDSFCETLDGWAKSVI
VGRGRLGGIPVGVVVTEVRTSEKIIPADAAIPASQENLMQQAGQVWFPDSAHKTAIRGMF
DEVLKFGAAIVDSFVNYEQPEFVYISPFAEQRGGAWAVVDRIINEGITEMYTDPQGRGEY
LD
Download sequence
Identical sequences jgi|PhycaF7|76378|fgenesh1_pg.C_scaffold_4000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]