SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|77225|fgenesh1_pg.C_scaffold_5000392 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|77225|fgenesh1_pg.C_scaffold_5000392
Domain Number 1 Region: 564-861
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.22e-53
Family Biotin dependent carboxylase carboxyltransferase domain 0.000000364
Further Details:      
 
Domain Number 2 Region: 868-1076
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.74e-48
Family Biotin dependent carboxylase carboxyltransferase domain 0.00000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|77225|fgenesh1_pg.C_scaffold_5000392
Sequence length 1077
Sequence
MNIAQHFITQTQALTEEQAMFQHHQRGENDAQNAALMAVQASTETRVQQLTEQQRAIAHQ
LSEALATTQNELASQFQQMQMLEGDRVMQIERFVDKKLGEALQKVNQSSQAINSQTDVAQ
KLLVEIEQTVANSQAAFASHIRQVVEKLQRARSEIQREIATRMRNQSGIWFGADNAGDSV
SRGGSEIRHLIRCTVSVLAVAEDPEFNDSEVVEILDELKKTLDTDRKRASRSSEEAVWTD
LINEYFTVETVHANSHNIEDVVKALRQQNSSHLDKPVESYQEIAPDSELHGAIVRLTNLE
AFTNAFPDVMTLFPLAKKALSVRKDPLVNVLHVILVDEHSEEANLLEQAEAYLKLVGQSL
RSHNIRRVTFSGRPQNIDNISAHNADMALYPNIYMFPGRLSYSEDKIVRHMEAPLAYKLE
LRRLQNYSVTPLASENKNVHLYLAKMKESDSHILVDALNALELNLSNPLVTKSSLPTKTN
HVYLNILPQAIVDPQYLEGVIHILAYRYAERLEQLGVSTVELKIIARFISEAPPIPLRLL
ATTSPSSPPSATRPTASLTMAKAMSNTVYVYYFLDLIEYNLLRQWRKYVQQRTRGGGAKI
TIPNLLMEVRELILNATGKTITETTRPRGQNDIGIVAWLLTLYTPEVPDGRGITIIANDI
TFKADSFGTREDTLFDLTSKLARSKGIPRFFFSVNAGVRIGMAESIKALYKVCWKDETNP
TKGFEYLYLTPEDYRIASADGAVKAELLVTSTGEERYVLNDIVGREIDLGVECLRGSGTI
AGETSRAYQDVFTLTYACGRSVGLGAYLVRLGHRTVQNTTHSLIILTGYQTLSKVMGKEV
YTSNDQLGGVKIMHTNVCCRSAISLAWMRLSVRWKGKSTQYDPRALLAGKVDEATGKWVS
GLMNKDSSSETLDGWTKSVIVGRVRLGGILVGVVVTEVLTPEKNIPADAVIPASQENLMQ
QAGQVWFPDSVHKTAIVIKDFKGEDLPLFILANWRGFSGGQRDMFDEVLKFGAAIVDGFV
NYELPVFVYISPFAEQRGGAWAVVDRIINEGSWWCAGVSQIKYSKKQFLQTMHRQDD
Download sequence
Identical sequences jgi|PhycaF7|77225|fgenesh1_pg.C_scaffold_5000392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]