SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|79590|fgenesh1_pg.C_scaffold_62000015 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|79590|fgenesh1_pg.C_scaffold_62000015
Domain Number 1 Region: 236-429,475-645,693-711
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.1e-65
Family LacY-like proton/sugar symporter 0.092
Further Details:      
 
Domain Number 2 Region: 1256-1484
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.12e-34
Family Tail specific protease, catalytic domain 0.00079
Further Details:      
 
Domain Number 3 Region: 7-98
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 2.34e-16
Family Antibiotic resistance proteins 0.00017
Further Details:      
 
Domain Number 4 Region: 884-1017
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0000000000324
Family beta-glycanases 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|79590|fgenesh1_pg.C_scaffold_62000015
Sequence length 1504
Sequence
MAVKRVVANIATPDPARAAVFYGELLGMPVVMDHGWIVTHGGEGSALAQVSFASEGGSGT
AVPDLSIEVDNLQQVLERMRAAGIPLEYGPADEPWGAIGLHGFDERIGILCRCGDQVVGS
AVHAGVDQRGGNLRRRKLPQTGGVARFEDAQQLLLDCIAFGVAALVVMMVGVHHVVQCMG
AHVKFDVGADPGAQACYAIADGVLLHGLVDRFHELPRVALRQRLQDLGARGERFQRPALV
LAAYLGTFLASLDISIVNVALPTLQQALHTDMAGLQWVINAYAIALSALMLSAGPLGDRY
GHRRMWLISVATFTLGSLLCACANTLATLVAGRAVQGIAGALLIPSAMPILSHAFPDARL
RARAIGGWSAFSAMALVLGPLLGGVLVQRAGWPSIFLINLPLGLLALALGVWGIPERRHP
QHAALDPAGQLLSIVALGALSYGLIAIGEHGLLAPVTLLALGVAAAGLILFGIVERRVVR
PLLPLDLFADRRFGMFNLASFVLGFTAYASLFFLSLFFQQAQGHSAAQAGSQLAPQFLLM
GVVSLLFGRLVAHLGLHAALVLGYALAGIALCAMATFEPATSRAFASAVLVLLGIGMGLA
VPATGMAVMASAPVERAGIASATMNALRQAGMSLGIALLGSLMGQRAVQHFAVSAQAAGQ
RGLVAQARELILQPSSMHATPQTLAWYRSAMASGFGWAMAVAALLALRALCRAFDLVWLL
LLLARICVASVPTFTTDRGHVLAVAADRLAALAACDTCFGRTEFMRVAGGMCGTPALGSD
RALLVLVAIFATVFTRLAHGADGAAIQAGGATPSPLLSGSFVHVGYSATDEQLPAAQLPL
FLDELQDLGNDTIILGQVRATRAGVGCASGVQDFEWIAGFPGKLGTVLDAAAARGMKVVV
GTTYSSGQCATFWQGQNATAVAQDAAQSLAQLGQQYGSHPAFAGWYITDEPAQVPIDRAS
FYRAIVTALKGSTPSRPVMVAPYLASSSVDPVSVGRAAAQFRTATGVDVQIWQDGIGAAS
HARLFQWDRAGHSTEAYYEALSAALGASGLWADIELFNHGSPLFLETGNGLSGAYRSASV
QRINQQLWSARSAGKRVAWLNQYHMSEVVGPGQGYGESPRMMNTYRGLYGLGASYSVDPV
QTTYSYSTAPDANYPDSTGHELFDRRVGDPRNPMDAGWVGVHGNVSITIDLGQRRRVDWI
GLHTMTRPAWGIVTPTSVEDAVLQAAAKAIQAQYLDVAEGARIAEVVRGWSAQQRYADSC
ADPKAFSARLNQDLDVFDGHFHVERVDASAGQDDWLMAWRADARSNGAGVREVRVLEGNI
GYLRLSTFYPLDLARPKLAAAFTLLADTDGLVLDLRQNGGGDDGSADLLVRTLLAAEITQ
VQSLQQRGQRSPVPLPPASLGLYLKPLVVLIDRRTGSAAEFVAYSLQAQGRARVVGSRSG
GAAHMFDDPVLLPDGYQISIPDRQPINLRTGTNWERTGVTPDAAGGDDPLFVARQLLARS
ASPK
Download sequence
Identical sequences jgi|PhycaF7|79590|fgenesh1_pg.C_scaffold_62000015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]