SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|79836|fgenesh1_pg.C_scaffold_11000210 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|79836|fgenesh1_pg.C_scaffold_11000210
Domain Number 1 Region: 1016-1288
Classification Level Classification E-value
Superfamily Thiolase-like 4.8e-73
Family Thiolase-related 0.00000404
Further Details:      
 
Domain Number 2 Region: 1316-1436
Classification Level Classification E-value
Superfamily Thiolase-like 1.82e-42
Family Thiolase-related 0.0000359
Further Details:      
 
Domain Number 3 Region: 681-995
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.39e-39
Family Crotonase-like 0.0018
Further Details:      
 
Domain Number 4 Region: 213-400
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.93e-39
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00054
Further Details:      
 
Domain Number 5 Region: 83-203
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 3.47e-25
Family Tetracyclin repressor-like, C-terminal domain 0.00079
Further Details:      
 
Domain Number 6 Region: 400-519
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.62e-18
Family HCDH C-domain-like 0.0026
Further Details:      
 
Domain Number 7 Region: 8-76
Classification Level Classification E-value
Superfamily Homeodomain-like 3.23e-17
Family Tetracyclin repressor-like, N-terminal domain 0.00094
Further Details:      
 
Domain Number 8 Region: 552-665
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 2.47e-16
Family HCDH C-domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|79836|fgenesh1_pg.C_scaffold_11000210
Sequence length 1438
Sequence
MAKPAHFSTKDRILGAAEELFAQHGFAGTSLRQVTSQADVNIAAVNYHFGSKENLVNEVF
RRRMDEMTGARLAQLERARAEHPGELRPVLAAFVEPALALAQDRQNGGAFVRVIARAYAE
KNDNLRKFLSDHYGHVLRAFGKAIGECVPGLSKEELYWRLDFLAGSLTYAMADFGLIKRP
AGVTEAAHRAHAAHELIHFAEAGPYTMSNSLLVRRAAVLGAGVMGAQIAAHLTNAGVDTC
CSTCLPRKEGPADGIVLKAIANLGKLSPAPLASKSLAEAITPANYESGLEQLKDCDLIIE
AIAERMDWKQDLYKKIAPFVADHAVLASNTSGLGINKLADVLPEQLRHRFCGVHFFNPPR
YMHLAELIPATTTDAAVLEGLEAFLVTTLGKGVVYAKDTPNFIGNRIGVFSILSTIHHTQ
QFGLGFDEVDGLTGPLVGRPKSATYRTSDVVGLDTMAHVIKTMGDTLPNDPWHEFFKSPK
WLDALISKGALGQKTGAGIFRKVGKDIVVLDLEKQDYRPADRAAAPEVVEILKIRNPAEK
FAKLRESQHPQAQFLWATFRDLFHYSAYHLADIAETARDVDLAIRWGYGWSLGPFETWQA
AGWKQVAQWIADDIVAGKSMSNAPLPDWVFDGRDGVHAAEGSYSPSRNAKLPRSSLPVYQ
RQRFPDPLLGEKFAPGETVFENDGLRMWHDGDGIAVVSFKTKMNTVSDQVLDGLQECVSR
AEKDFQGLVIWQQKEPFSAGADLAGALGLLQAGKVDQFEEMVANFQRTSQRIKYSLVPVV
AAVRGLALGGGCEFQMHSAKTVAFLESYIGLVEAGVGLLPAGGGLKELAVRASQAAGPGG
DVFAELKKTFETVAMAKVSNSAVNAKELGLLRSTDKVVFNSYEALHIAKAEARALAEAGY
RPPLPARRIQVAGDVGIATFKMMLVNMLEGRFISPYDYEIAERIATVLCGGKVDRGTLVD
EEWLLTLERKHFVELAQQEKTQARIAHMLKTGKPLRAHLGGHTGKKLREITAMTKQIQDA
YIVAATRTPVGKAPKGMFRNTRPDDMLAHVLRSVVAQAPGVDVNRIDDAIIGCAMPEAEQ
GMNVARIGVLLAGLPNTIAAQTVNRFCSSGLQAVAQAADAIRLGNADLMLAGGTESMSMV
PMMGNKIAMAPSVFDNDHVAIAYGMGITAEKVAEEWKVSREDQDAFALASHQKAMAAIQN
GEFKDEISPYEIVSHLPDLADGQRIITRNKIADTDEGPRPDSSAEGLAKLRPVFRNGQFG
GTVTAGNSSQMSDGAGAVLLASEQAIKDYGLTPLARFVSFSVAGVRPEAIKDYGLTPLAR
FVSFSVAGVRPEVMGIGPIAAIPKALKQAGLTQDQLDWIELNEAFAAQSLAVIRDCGLDP
SKVNPLGGAIALGHPLGATGAIRTATLLHGLRRRQQKYGMVTMCIGTGMGAAGIFEAL
Download sequence
Identical sequences jgi|PhycaF7|79836|fgenesh1_pg.C_scaffold_11000210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]