SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|79903|fgenesh1_pg.C_scaffold_11000277 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|PhycaF7|79903|fgenesh1_pg.C_scaffold_11000277
Domain Number - Region: 13-86
Classification Level Classification E-value
Superfamily Thiolase-like 0.0132
Family Chalcone synthase-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|79903|fgenesh1_pg.C_scaffold_11000277
Sequence length 117
Sequence
MISMAAWPTSTAANFSRLAQEPGVKMIVTPKAYYATHDTMPPPHQVIKTNANGMSGLVRV
LKDKAPVLVFSSLCAGAAYAVYYAHHQQFAEKKVMRQGVINDIKRDRLKRREMQDQK
Download sequence
Identical sequences jgi|PhycaF7|79903|fgenesh1_pg.C_scaffold_11000277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]