SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|80096|fgenesh1_pg.C_scaffold_12000011 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|80096|fgenesh1_pg.C_scaffold_12000011
Domain Number 1 Region: 43-130,201-376
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.15e-74
Family Tail specific protease, catalytic domain 0.0000148
Further Details:      
 
Domain Number 2 Region: 105-192
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000087
Family Tail specific protease PDZ domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|80096|fgenesh1_pg.C_scaffold_12000011
Sequence length 514
Sequence
MRAARTATLLLALLPALSWAQQTAPAPSQETGGQAASSEEAVTSKVPLEDIRRFVAVYNA
VRAAYVDPVDDKKLMQAAVRGLLLDLDPHSTYFNKEDAQAFDEQASGAYEGIGVELQQQP
DNASMKVISPIDDTPAAKAGILAGDLIIAIDGKPISAIDASEPLRGPAGSKVVLTIVREG
KPKPFDVSLTRQTIRVTSVRSRLLEPGYGYIRLSTFQADTGSDFQKHVQQLQKQSGGQLK
GLVLDLRSNPGGLLTAAVQVADDLLDKGNIVSTRGRISISDARFDATPGDLLKGAPVVVL
VDAGSASASEVLAGALRDNKRARVVGSRTFGKGSVQTVLPLDNGDSVKLTTARYYTPSGK
SIQATGIVPEVELKPAARPEDEALPASLSDYSEATLPGHLRGDDEGTEGYHAGAVLPGDG
PINDALAELKNPGSVAARLKAEAAKADAAKAAKATAAKPEAKVEPKPEAKPEAKPEAKPE
AKPEAKPEAKPEAKPEAKPEAKPEAKPAPAPAKP
Download sequence
Identical sequences jgi|PhycaF7|80096|fgenesh1_pg.C_scaffold_12000011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]