SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|83070|fgenesh1_pg.C_scaffold_34000001 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|83070|fgenesh1_pg.C_scaffold_34000001
Domain Number 1 Region: 191-491
Classification Level Classification E-value
Superfamily Autotransporter 4.05e-35
Family Autotransporter 0.026
Further Details:      
 
Domain Number 2 Region: 495-609
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 5.83e-29
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.0038
Further Details:      
 
Weak hits

Sequence:  jgi|PhycaF7|83070|fgenesh1_pg.C_scaffold_34000001
Domain Number - Region: 29-117
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.00621
Family Clp protease, ClpP subunit 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|83070|fgenesh1_pg.C_scaffold_34000001
Sequence length 609
Sequence
MKYSKLSLALAGLMGVAAISVVDDVMAMNYHVQGDRIFLSGDVTYADVVSLPALLAKAQA
EGRPVREVVLRTSNGGALIAGEWLQGIIRTSGLNTIVSGNCISSCSIMQSGGVERYLAGD
LPLIDSVQIHAASSGGKVIYTPSPRMTQIYTGNYGGGMDAGLLHKAMYEVVKPNGLLVFR
DPARSTGSSVAQSVSSQPGMRHGSLFNQLAMHLVEPAPGSVAGSGDAGRSHGIWARGLAS
HGRIDADGGVAGLSHNIGGIVVGADTRVADDRGTLGVSVAAADMSTKASDGSGFTGDVRA
LDVGGYLDATYARGYLSAAVRYTDLRHDTRRSIGGIDGLQQPLRAKYSNDAISARVEHAF
SFTTGKGLVIQPLLPVVDYARTSATRFNEGQGAGALVGRSGSLESIRVGAGLQLFKTFEG
NNGERITPRARVVWQKELGDSQARYSTGFAAAPDLVFGASSQAVGEQVLAWNVGVTSRAS
ERLSIMADYVGPSMQIAVFSARPYDRRFLDEANQRDASEDGFAFVYFDVALDVHTAALAQ
DCAAVCVFVNDRLDAPVLHALHAMGVRAVLLRCAGFNNVDLAVAEALDLFVARVPAYSPE
AVAEHALAL
Download sequence
Identical sequences jgi|PhycaF7|83070|fgenesh1_pg.C_scaffold_34000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]