SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|83499|fgenesh1_pg.C_scaffold_29000011 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|PhycaF7|83499|fgenesh1_pg.C_scaffold_29000011
Domain Number - Region: 17-78
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000135
Family Tetracyclin repressor-like, N-terminal domain 0.015
Further Details:      
 
Domain Number - Region: 93-177
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0233
Family Tetracyclin repressor-like, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|83499|fgenesh1_pg.C_scaffold_29000011
Sequence length 829
Sequence
MSTHRMSPHSDPTAPTRGRPPTITPERLADIGIRLGLPNLTMANVAAELAVTQAALYKRV
ANLEALKRLVAEAVFQRWQIPRASVDAPGGLEAYLMRFVESLCEVVKAHPGLPPYLLRRT
VATAPMLEKIASHQAHVADVFGLPVDKARWLLATIAFYCIAGADTIYAIADDEEGQVITE
FKQGMRALVIGSLEAWPGSTGRIAWCREYNAAMPATPTLDDLRRYAVARTLFKPTTLLTA
IRRLGFVQADPIRAPARAQDLTLRHRVKDYRAGDLERRYTRLPVEEDCLVNYGFLPREHL
ALMHPRVSKREWDAETHRRAADVLAFVRERGSVHPREVDQAFAHGRVTNYWGGISNASTH
LLDGMHYRGLLRVQRRDSGTRIYAVAEHAEPDASEQAQVERAAALIDLVVRKYAPLPSAS
LTYLVRLLGYGAPHLAEQTRQALALAKQQLASCTLEGTTWYWPVDENPRSRRHAPDEQVR
LLAPFDPVVWDRRRFELLWGWVYKFEAYTPAPKRQYGYYALPVLWHDQVVGWANLSVRDG
ELVSSVGYAGKSLARDRVFRGALDDELQRMAEFLATSLRPGAHQSGQLPIQPPMRHHRQH
HHASGDAGVPGQRGQTRTHAQRAHGKHGAEHQQCPTDCAQLLNGLCAQTANASRVRSVPA
NAQSPAAKVRHNGCAVVVAVSAGNSASNNAPSTNCSIHARLGVRSVACTNIAAQARKNTC
TSHAARPSMTHQSGADHGGAGEADDEVQPAQGGVGKTPQMQAIQHALGIGGDARVLLDLQ
QLPAAAIEQQRKVKKSAKIFLWVITPLTMATSMNIAQTPTIQRPHMAGM
Download sequence
Identical sequences jgi|PhycaF7|83499|fgenesh1_pg.C_scaffold_29000011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]