SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|84460|fgenesh1_pg.C_scaffold_22000077 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|84460|fgenesh1_pg.C_scaffold_22000077
Domain Number 1 Region: 3-139
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.57e-21
Family Tyrosine-dependent oxidoreductases 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|84460|fgenesh1_pg.C_scaffold_22000077
Sequence length 153
Sequence
MKLMVIGASRGLGRAFVEGLSSAGDTVIGVSRKRPRDLECPEGVTLQWIEADLSQPTLAA
NHIAAQAPADLDVLIHNLGIWEETAFSDEYAFLDESDAALTQLVDVNITATLVLLQRLLP
RVLGAPRPQLVLTGSTSALPRSGRPEVLPRSLR
Download sequence
Identical sequences jgi|PhycaF7|84460|fgenesh1_pg.C_scaffold_22000077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]