SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|86954|fgenesh1_pg.C_scaffold_605000005 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|86954|fgenesh1_pg.C_scaffold_605000005
Domain Number 1 Region: 82-125
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.00000000000196
Family H-NS histone-like proteins 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|86954|fgenesh1_pg.C_scaffold_605000005
Sequence length 127
Sequence
MSIDLTGLSARELGALIRTAKKQQTIVAKRRPITKVRAQLTKLAKTEGYTIEELFGSAPA
TRARKAAPAAKAPSKTAGRKLGKVAPKYRNPANPKETWTGRGKQPRWMAELTAKGNKKPE
DFLIKKA
Download sequence
Identical sequences A0A0L8A4R8 A0A0M1F156 A0A2K3UGY3 T5KX67
WP_010480700.1.11095 WP_010480700.1.15733 WP_010480700.1.19137 WP_010480700.1.22719 WP_010480700.1.2303 WP_010480700.1.31544 WP_010480700.1.33142 WP_010480700.1.39294 WP_010480700.1.39844 WP_010480700.1.42768 WP_010480700.1.45034 WP_010480700.1.45403 WP_010480700.1.48568 WP_010480700.1.48888 WP_010480700.1.52134 WP_010480700.1.52648 WP_010480700.1.53975 WP_010480700.1.58314 WP_010480700.1.6854 WP_010480700.1.70371 WP_010480700.1.73231 WP_010480700.1.76727 WP_010480700.1.77232 WP_010480700.1.78518 WP_010480700.1.80849 WP_010480700.1.84440 WP_010480700.1.88566 WP_010480700.1.89344 WP_010480700.1.90468 WP_010480700.1.97949 gi|386717000|ref|YP_006183326.1| jgi|PhycaF7|86954|fgenesh1_pg.C_scaffold_605000005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]