SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|90163|estExt_fgenesh1_kg.C_20370 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|90163|estExt_fgenesh1_kg.C_20370
Domain Number 1 Region: 263-543
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.42e-88
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000175
Further Details:      
 
Domain Number 2 Region: 51-295
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.97e-73
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|90163|estExt_fgenesh1_kg.C_20370
Sequence length 561
Sequence
MLRTARLLPLSARRSFASRAGVLGPFSNVLDGALNVKSAQFQESQEHMANLTAELRERVA
KARLGGGEAARERHESRGKMPVRDRIDSLLDPGSPFLELSPLAAYDMYGGGVPSAGIVTG
IGRINGVECMILGNDATVKGGTYFPLTVKKHLRAQEIAQENRLPCVYLVDSGGAFLPLQA
DIFPDRDHFGREFYNQATMSAMGIPQIAVVMGSCTAGGAYVPAMSDESVIVKGNGTVFLG
GPPLVKAATGEVITPEELGGADVHCRTSGVTDHYANNDAHALDITRRIVSNLNYRKEPSV
TQTPIEEPIYSPDELGGVIPVDSRKPFDVRKVIARIVDGSRFDEFKKEYGPTIVTGFARL
YGNPVGIVANNGILFSESSVKAAHFIELCSQRGIPLLFLQNITGFMVGKKAEHGGIAKDG
AKMVMAVSNAKVPKITCIIGGSYGAGNYGMCGRAFSPRFLYMWPNARISVMGGEQAAGVL
AQVQRDNYERRKETWSTEEEAKFKQPILDKYEKESSAYYSTARLWDDGIIDPKDTRKVLG
LSLSAALNEKPQETKFGVFRM
Download sequence
Identical sequences jgi|PhycaF7|90163|estExt_fgenesh1_kg.C_20370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]