SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|97217|estExt_fgenesh1_kg.C_90695 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|97217|estExt_fgenesh1_kg.C_90695
Domain Number 1 Region: 2-177
Classification Level Classification E-value
Superfamily Thiolase-like 2.23e-50
Family Thiolase-related 0.0000349
Further Details:      
 
Domain Number 2 Region: 178-299
Classification Level Classification E-value
Superfamily Thiolase-like 2.45e-37
Family Thiolase-related 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|97217|estExt_fgenesh1_kg.C_90695
Sequence length 301
Sequence
MKSLAIGAQSLLSGSQQIVLAGGFESMTNVPHYLPKARAGYRLGNGTLVDGVIHDGLWDP
YNNQHMGMCGEKCAEDFGFSREDQDNFAIESYRRAVDASERGFFKTEITPVTINGRRGSK
VFDTDEEMFNTKPEKIASLRTAFKKDGTITAANASTLNDGAAAMVLMTGAKARELGVTPL
ARIRGFADAAQDPVEFTIAPSKAVPLALHHAGLQLSDVDYHEINEAFSVVALANMRLMNL
QHDRVNVNGGAVAIGHPIGMSGTRIVGTLIHILKEKDATIGCASICNGGGGAGAMVIERL
N
Download sequence
Identical sequences jgi|PhycaF7|97217|estExt_fgenesh1_kg.C_90695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]