SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|10006|gw1.3.1.1 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|10006|gw1.3.1.1
Domain Number 1 Region: 1539-1592,1644-1720,1841-1862,1906-1977
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.01e-34
Family FabD-like 0.0013
Further Details:      
 
Domain Number 2 Region: 3048-3256
Classification Level Classification E-value
Superfamily Thiolase-like 1.15e-25
Family Thiolase-related 0.003
Further Details:      
 
Domain Number 3 Region: 1423-1534
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 2.99e-18
Family MaoC-like 0.013
Further Details:      
 
Domain Number 4 Region: 2680-2907
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8e-17
Family Tyrosine-dependent oxidoreductases 0.025
Further Details:      
 
Domain Number 5 Region: 12-167,275-379
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 0.00000000000000314
Family FabD-like 0.0053
Further Details:      
 
Domain Number 6 Region: 443-682
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 0.00000806
Family FMN-linked oxidoreductases 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|10006|gw1.3.1.1
Sequence length 3259
Sequence
IDADKYQFIPEFGGQGLSYWTELQRLYAESKTDSITRKWINEAATALLEESSTDEAKRSA
AFEVVIDLNGWLQSLEIGNAPKGLAMSRVFFSMPLVMLTQCANYLNFLETTGVSHENVIK
NSSTAIGHSQGVVSAVVFSAAKTAQEFMVIGVSVLRYMFWQGLRAQETYQQLLTLHKQNG
KRMEDAGPMLAVRGLKKEHVLNAIESVKRRTKTSDLQLSLINAPDMMNVTGFPATLTLLK
QTLESLFAKPDANQTRILHSQRKPTGSLSFLSLSAPFHTPLLAGAKPKLMQDVQRAKCAI
KGSQLQVPVYTTNTEATNLQAVDDVVDELVDLQLLQLVDWPATWTKIAEHHANTTHVLEF
GPDLGVAKLSNKIVEGLGTNMVIATAKYPVMNVSLKNAPLIGLQQFIDATAAFTPVETWE
KKFALQVTESNKLYNRFTRALNKPPVMVAGMTPTTSLNGIDLVAATQNAGFHAELAAGGL
SRPNIFEDAVYGLVSKIKPGLGITINLLYLNAKQWGFQFPMVLRMRRSGVPIESITIGAG
IPTMERAQEILSQLESVGIKVVCFKPGSVDGIHAVLEIAAAMPRMTVMMQWTGGRAGGHH
SFEDFHQPMEETYAAIRRVPNVLLVVGSGFGNWEDSKQYLTGEWSVARGHLHKMPVDGIL
LGSRVMVAKEAATAPEVKKLLADTPGIESELEWGTSYTGVVGGVVTVTSELGEPIHVVAN
RGALLWKEFDDKYFSIPREQIELTLRLNKRDIITRLNADFQKPYFGCKRDVETGESVPAD
LEEMSYADVLTRLIDLTYVEVEGKPHRWVHDSYFSRVSRFITRAEERFNREKAGEIFDQV
ELKANPRGTVRAFVVKYPQAASTLLSVLDVDFFLDLCRTGGKPVNFVPVIDTEFKTWFKK
DSLWYSEDLDAVPERDAQRVLVLQGPVAVRYTTVMDEPVADILNSITSGLTNVVKESGAV
ADATPNCAVQLVDIVGVELTESEDAMEMFITAEESAVPPADDWLSALSTVSNKDWIRALI
LSTHVVEGKKWLSNPVRQLLKPQIGQKYVIDTAGIRVFDSSIDIRGPVIEITKKAAVISV
VVNEVRPAVTGLKAGVVALEMSFHYHPELSCSIHAEVSDFIDKVKAFYARFWVANDGKEE
ESCKVACAESVKSCFTSNLLITKEDLAAYCAALDLSGDEVGAPADFSTVVSWRPLIQLVL
AKEVKGNLLDLVHLKHSYKLLSSRKASATFLPGDDIVSTSNIRSLRIVDSGKSVHAVAVI
SRKTVNAQMMEVLEPLVELNSEFLIRGSFDDFESTFSIDKSTDTFHLCRQEDVEILKSKS
WLKLIGGVSLNIGDRLSFDLTTKTQYASIGSLRSVEVSGILCHEETGSNVKIGTVEFKSH
DVNESPLVTFLRQVKPQDAKPSGMFVNGGSYLLDKPLEINVPTDALAYAVASRDLNPIHR
SRYAAILGHLPMDKPIMHGLWTATKVRALTIQSFGQDLDSNVVEFNVTFDGMVYPGDKLF
MQARHIGVENGNKVMSIEVVNTSGERVISARTVVKQAPMAFVFTGQGSAEVGMGMDRYEA
SVVVREVWDRGNEHLLNTFGFSILDIVRTNPTAITVHFGGQKGRRIREKYMSLTTEDPMT
QEIVPLLPEINARTQSFTFSQPEGLLFATQFNQPALVLLEKAMFSEIETAQLLPDDAYFA
GHSLGEYAGLSSFAGALALEDVVEVVFLRGLIMHKAVKRDADGRSDYGMVAANPMRVGPH
LTEELLYSIVDGIEAASDNLLQVVNFNIQQYQYVVAGENVNLEALSLALSACKTPKAIEV
EKVIADALDQARTRKEKCAQTDCPFTLTRGLATIPLVGIDVPFHSRELLGGVPSFRELLR
TKFNPHVLERQLPLLLNRYIPNLVASPFSLERSYCEKVYAATKSPFLAEVLEPKQWALTT
RAELTHLLVVELLAYQFASPVQWIKTQALLFSKGDVRRFVEVGPSPTLTNMALRTLQVGD
FSYLPREILWYQRDREVVHFEVETSNISASEYARGLAAQAAAVSAKMEEVPAIAAIVVAP
VVAPIMQAPAPIATIAAVDAPVAALHILRVLLAVRLNKDMVEIKEDTDVKXLCAGKSAVQ
NEILGDLEKEFGVSVPDGAGEVPLKELASKFSSYNTLGKVTNGLINKLVASKMPGGFTMS
SIKKYLSSEKSLGAGRMESVLAHSLLLAPQARFKSDADARKWLDNSVSDYASFAGISLDR
PTVGAAPAAVSMPFNPALNSIPTVSDQPVEAKHALLVMLAAKFGKAFSEVPEMATIKELS
AGKSAVQNEVVGDLEKEFGSGPDDAAEIKLTELSGKFPDYDSPGTVTSALISKMLASKMP
GGFGLSAIKEYLSSECCLPNGRIESVLLHGLTQNPKQRLKDDMTAKKWLDDVVDDYAKYA
GITVPHLSKLGGMAAVPLMQQVQAALPSDFEKRLNTMITDQVEALNSYLDVDQLDWHRRM
ESEVETRENLETALSQWEMEHGDFYSANIAGKFDAMKERQYDSYWNWVLQDTLELFYSAT
SKSLTSSVIVKEGLERQKLCLCNRATPELLRCVQFFAARGGSEFKLLAKQVKEALGIDPV
HIPSFTPMQPQLSIRENGELAYAEVPREGLVDSVHYVDEVAGGLDYNNAEHQYESKRMGL
PHVHVRKPSDVDQTLRMHDVESTRVLLFCMREMASTGISFTGKVALLTGCGKNSIGAEIV
KALLEGGATVFVTTSSFNMKTTGLFREIYERFGSRGSRLVVLPFNQASKLDVQELVAHIY
NVHNLDLNFVIPFAALSDVGRISDLGSRSELAHRMMLTNVVRLLGEVAAAKKTRGVTTRP
ALVILPLSPNHGSFGGDGLYAESKLGLESLMGKWHSEGWNQQISIIGAIIGWTRGTGLMM
DNNVVASGIEKMGLRTFSTEEMGFNLSALMHPSMTDRAAxxxxxACGCVXLxxxxILFDK
GNWVDAKTKEVVPDHEVKARYEEDILEHSGIRIVEPELFDGYDPKKKMILHQIAIDKKMA
PIEVADREEALQFRKELGENNVDVFQNASGSWMICLRKGSVLNIPRALDFDRFVAGQIPT
GWSAERLGLPADLVESVDPITLYTLASTMDAFVAAGVTDPYEFYQYVHVSEVGNTSGGGM
GGFRAFSQIYKGRLLGKSAPSDILQECFINTPPAWVNMLLLSSSGPIKTPVGACATAAES
VDIAVETIKSGKARVCIVGGYDDFGEESAYEFAQMKATSDSVKEIGMGREPKEMCRPCSS
TLGGFMESHGAGIQLLQCA
Download sequence
Identical sequences jgi|PhycaF7|10006|gw1.3.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]