SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|100340|estExt_fgenesh1_kg.C_130177 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|100340|estExt_fgenesh1_kg.C_130177
Domain Number 1 Region: 382-488
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000235
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|100340|estExt_fgenesh1_kg.C_130177
Sequence length 727
Sequence
MAEMAEKISKYLHGDLDKVVPTTVVMVAMTSMILGLVFFLMGLFRVTSIANYMPYPVIAG
FLSGIGAQLMKNGVHMASSKALTAAFFTWDIQMLVLPSIAFAGFARLGQYFKFPVAFSFP
CLLALSLMGFQVISSMYDSNMEKLAKEGWVFSWDPEVVAQTPMWFPWAEIDFSQVHWHTL
THECMEFMISLIILGALKYSVATTSLSTLFGRDISPDNEMRVIGMANLASGLMGCCGGCH
YLSAMGIMKQFEAHEKVPALVCAFLVVLLWMDGIRMLQFVPKFIFGGLLLSVGLHFLEAY
LVTPFHFLKPIEKFTVVLITSSFLVIGMLESVAMGIIISMIELIWRIHAVGCVHHETTGA
LTRSAVDRTPEQTAYLDAEGSAIFVLRLQGYLFFGTSVNLLERMETRVHSLDFPKLKFVI
IDFGLVPSFDATALLNFRKTSALAEMYMFDIYFCGLKPKIELALRQNHYSQRIHLLSSDV
DIALEICENELLPDDICTTPATPRPGSSLNEWKRMSQLQLWEHFMAASTEHEGTSGYQKL
LPLAGYLDIVVVPNGSQLVPERLKDDTYFICFGFMNFVTDSEFSNAHNIPGVRYSEVDGN
GRVSEGYQANLHAEEEDGNSFIHRRKLSFVVPEESQWTPFTTAKSRLLKIGPGSVITPNV
AGMDPDYKYFATSDCVVLRLRAVAMETLETRAPHTAVAVLKLINVRLASRFRHSSKRVSQ
MSSLLYK
Download sequence
Identical sequences jgi|PhycaF7|100340|estExt_fgenesh1_kg.C_130177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]