SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|112844|estExt_fgenesh1_pg.C_20279 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|112844|estExt_fgenesh1_pg.C_20279
Domain Number 1 Region: 344-424
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000687
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|112844|estExt_fgenesh1_pg.C_20279
Sequence length 490
Sequence
MLLMIPETVAFSYAANLDPLNGLYATGFLGVAKTTIEVCKNDTMRFGECEIAGELKWMSV
SSATTWVTIGLVLVTMAIMHYFPRVPYVGHLIPPTLVAAVVGVGFEFGINRPLLGYDVRT
IGDTSPLAGGLPTFAIPKFGDVQDWGVVLSTAASIMAVGLFESLMTLQSVVDLKKEQLSQ
TATQKECIAQGIGNVLCGFFSGMGGCSMIAQSNGNILNGARYRLSSFMGGICTFLVVFFA
SSVIERVPVACLTGILFVIVIHTFYWPSLKLIFRVKIADAIAIILVTVLAAAMNLAIAVI
VGVVWQCLVNGWQSGFQLSVRTGMEVVPVVNAHDRAADHELLTSHEEAKIYYIKGQLLFS
SVASFREFFDVLHDPNVVILDLQDCVFADFSAAAALREAAMRYRDAGKTLVARNLDPKSL
DMLNHDFGWDSVEHIQIATPGTATNGDELVKSKIDKECASRYSRASQASLHQLHIPSPHE
TSTPYRAAEP
Download sequence
Identical sequences jgi|PhycaF7|112844|estExt_fgenesh1_pg.C_20279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]