SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|114639|estExt_fgenesh1_pg.C_90431 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|114639|estExt_fgenesh1_pg.C_90431
Domain Number 1 Region: 100-200
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 9.68e-33
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 53-115
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3.59e-23
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00017
Further Details:      
 
Domain Number 3 Region: 2-75
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-16
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|114639|estExt_fgenesh1_pg.C_90431
Sequence length 200
Sequence
MEDGTFHRFHTNNTVLATGGYGRAYFSCTSAHTCTGDGTGMALRAGIPLQDPEFVQFHPT
GIYGAGCLITEGSRGEGGILRNAEGERFMERYAPTAKDLASRDVVSHRSLIWNTDLTETL
ELRNLLACASCTMHGAEARKESRGAHAREDFTERDDVNWMKHTLAYHSDEGKTHIAYRAV
QDQTLDENECKHVPPFARVY
Download sequence
Identical sequences jgi|PhycaF7|114639|estExt_fgenesh1_pg.C_90431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]