SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|115470|estExt_fgenesh1_pg.C_130115 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|115470|estExt_fgenesh1_pg.C_130115
Domain Number 1 Region: 3-156
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 5.23e-41
Family Ran-binding protein mog1p 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|115470|estExt_fgenesh1_pg.C_130115
Sequence length 172
Sequence
MIRPLFGGALSCEIPEGFADVSSFRQVPDNQEVFANAETDQCVIVELLQYEESVLDSGSA
RYFFNEIAQSNGCGPDEVTVLLEQKADERHAPAIVDAPHSTQLIVGDQRVAKFKEGDHAK
NVVRVYLGNIRLPGVTTDVVLSVSAPMRINPASSSHGAFQFEDNSELAFGPR
Download sequence
Identical sequences jgi|PhycaF7|115470|estExt_fgenesh1_pg.C_130115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]