SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|122589|estExt_fgenesh1_pm.C_160133 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|122589|estExt_fgenesh1_pm.C_160133
Domain Number 1 Region: 1-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-34
Family Nitrogenase iron protein-like 0.0092
Further Details:      
 
Domain Number 2 Region: 220-347
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.00000011
Family DRTGG domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|122589|estExt_fgenesh1_pm.C_160133
Sequence length 372
Sequence
MTKHLLVLSTGQHVGKTTLSLGLVKTLQAKFQGSDKQVAYCKPVGQQHVPVGGDLRVDKD
AFLFKEHFGLVQDYKDMSPVIFPDGFTRDFIDGKVTSQQLMDSIQVAHRNLYEQSDFLIC
EGTGHTGVGSICELNNAQVAAELKIDAVCVALGGLGSSFDQLAMNREMLKQNNVRLRGVI
LNKVNPKKMDMIQDYYSRALKRWDVPLVGCIPDLKDLSCPTMADYAKLLKSDLVSGAEAS
LRYFSSTRLALAPVDTSNLFKAIPNQLVITHSGRKDVIDAIIGNQEASTSHGENLKSGLI
LTGWNPPSAELKRRLDADNIPCIYVSPDKADSYTITARISQFTAKIRREDVERIELAADH
VSKHCDFSFLDG
Download sequence
Identical sequences jgi|PhycaF7|122589|estExt_fgenesh1_pm.C_160133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]