SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|ZYRO0A02464g from Zygosaccharomyces rouxii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|ZYRO0A02464g
Domain Number 1 Region: 59-165
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.96e-36
Family Frataxin-like 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|ZYRO0A02464g
Sequence length 176
Comment similar to uniprot|Q07540 Saccharomyces cerevisiae YDL120W YFH1 Yeast Frataxin Homologue mitochondrial protein that regulates mitochondrial iron accumulation [Zygosaccharomyces rouxii] Complete CDS. ZYRO0A02464g
Sequence
MIRSTFVRASRLGRTCTAASAIRRASLLPIRKWNYPHPQLHAQRFYAESFTLGDEIPPEV
TNLSFQTYHEQADTFLESLSDQLEALSQKYPESVPDVELTQGVMQLELGGIGSYVINKQP
PNKQIWLASPVSGPNRFDFYKNEWISLRDGSKLLDILNEEINQAVTEENVTLTPSD
Download sequence
Identical sequences A0A1Q2ZSS1 C5DPD4
XP_002494478.1.66507 gnl|GLV|ZYRO0A02464g 559307.ZYRO0A02464g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]