SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|ZYRO0F04796g from Zygosaccharomyces rouxii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|ZYRO0F04796g
Domain Number 1 Region: 561-675
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.34e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|ZYRO0F04796g
Sequence length 735
Comment similar to uniprot|P53394 Saccharomyces cerevisiae YPR003C Hypothetical ORF [Zygosaccharomyces rouxii] Complete CDS. ZYRO0F04796g
Sequence
MSPSSSSLLRDGPHSSERDYGSNGCTSCGPKPNRCPCQRDSLQSCKSFRPLVPITESSVS
SPLNSVNHKKLSPNEIEIRPSIWDVLPYYLPFFSWLPNYNISKCIGDLIAGVSLASFQIP
LALSFATSVAHVEPLCGLYSLAFTPFIYAILGSVPQMIVGPESAISLVVGQAVEKMISHN
PDLHTLQLSAVITFISGGFLFFFGLCRLGFLGNVLSRALLRGFISSVGLVMIINSMISEF
KLDKILKDLPVHYHTPFEKILFLVTYAPNNYHGPTTALSLSCFFILIMTKIIKKKLMPRC
RWIVFVPDILLLIIGTIFLSIKYRFKHNYSISTVGDFNTKGLDKLLNPLSAENRGLIPQL
LSAGFITAMLGFFESTTASKSLGSSYDLAISSNRELVALGSMNLFSSILGSLPAFGGYGR
SKINAFSGAQTVMSGAFMGLLVLLTIKFLLPMIHYIPICVLSVVTTMVGISLLEEAPADL
MFHFRCFGYDELLVFTLTVLTTMFYSVEVGICIGCGYSVISIIKHSAKSRIQILARVQGT
SRFVNSDDYLKQTNREHANENLELEELEGCLIVKIPEPLTFTNTEDLKERLNRLEKFGST
RVHPGARGRRSRSSTRYVIIDLHGMTHMDSSAAQILLEIVSSYRKRDVRVFLARVTIDAR
VRERLEKSGVVDLVEDNVPMSATNVNQEIYASSYFLTIEDALTAMEDHESANFSSDLVAD
NLSLVSPSLTDSGIV
Download sequence
Identical sequences A0A1Q3A2M5 C5DXG2
gnl|GLV|ZYRO0F04796g 559307.ZYRO0F04796g XP_002497406.1.66507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]