SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427705529|ref|YP_007047906.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427705529|ref|YP_007047906.1|
Domain Number 1 Region: 269-521
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.67e-43
Family Nitrogenase iron protein-like 0.00000181
Further Details:      
 
Domain Number 2 Region: 218-295
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 8.5e-16
Family Domain of the SRP/SRP receptor G-proteins 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427705529|ref|YP_007047906.1|
Sequence length 524
Comment signal recognition particle-docking protein FtsY [Nostoc sp. PCC 7107]
Sequence
MAFNWFRRQYNDSSDTPSETQQAENTPAPVTQPEATETSDANPTTAPESAADLLAFAKAA
YKNIQQKQQSETEETAPTSSATPETVAAVTEEVVTPVPEPVAIIEAQQLEATVEEVPLTE
AEIPLNAEEPTSIETQPTETAALSFLERAAAERQAKQERLIASAIEVPEPELAQPATVSE
ATDTEIPDLLFDEGFVWSAELLAAQGRRAEDISIEEITWLKKLRQGLDKTRRSILNQLKA
IVGQGPLNQAAVTEIESVLLQADVGVEATDYIISALQKKLREEVTPPEEAIAYLKQLLRD
MLDEPIRKSDKPSFAPEKDNLNIWLITGVNGAGKTTTIGKIAHLAQKSGYRCLIGAADTF
RAAAVEQVKVWGTRSGVEVIANPGKNTDPAAVVFDAIAAAQARETELLLVDTAGRLQNKK
NLMDELSKVRRIIDKKAPNAKIESLLVLDATLGQNGLRQAEIFSQAAQLSGVVLTKLDGT
AKGGVALAVVQQLGLPIRFIGAGEGIEDLRPFSSYEFVEALLSG
Download sequence
Identical sequences K9Q6F9
WP_015110998.1.60169 gi|427705529|ref|YP_007047906.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]