SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427705881|ref|YP_007048258.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427705881|ref|YP_007048258.1|
Domain Number 1 Region: 316-412
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000000419
Family Pentapeptide repeats 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|427705881|ref|YP_007048258.1|
Domain Number - Region: 81-158
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0251
Family Glycerol-3-phosphate transporter 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427705881|ref|YP_007048258.1|
Sequence length 448
Comment pentapeptide repeat-containing protein [Nostoc sp. PCC 7107]
Sequence
MAIESNSPNPPSPEPLPEQEPDDFDGDSRDNHLSPEALTAQQALAAISSLQSSHNAAVMQ
QARSSMQQRPTQQFTVKPRALMLTIAAIAFTLLGAILNNWVVGMVGTLLTLVLSLAMLLP
WLQYVLKEWFTPEDRTLFVGFLGLIAAIVGFIKFSGIGDRLLILGRRINWEASGTLAEWF
GALGQILIAIIAVYVAWRQYVISKDLTIQQNLLTVQQNIITQQQTIDSYFQGISDLVLDE
EGLLEDWPQERAIAEGRTAAIFSSVDGSGKAKILRFLSRSKLLTPLKRDRRLGRAILNGM
GGYAEDRLEGVRVIDLGVMLATADLSSTDLRWTDLSEANLVRANLSACDLVKANLSRTIL
YHTNLNSADMNGVRLFYGSVEKASPRSRTEPPNYETGEHTGAVIENADFTNVQRMSETNR
YYCCAWGGETTRATIPGGCEGIPNLLGK
Download sequence
Identical sequences K9Q6X1
gi|427705881|ref|YP_007048258.1| WP_015111348.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]