SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427706131|ref|YP_007048508.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427706131|ref|YP_007048508.1|
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0894
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427706131|ref|YP_007048508.1|
Sequence length 95
Comment hypothetical protein Nos7107_0688 [Nostoc sp. PCC 7107]
Sequence
MRFWHFWLNSLFLSSQHQPAHFIEFVMLVLTILLLGIWGVTQELPYMLLCLSYAIGAAIS
MLVREAIAPSPQAKISRFTALLLLVISLYGFVDFL
Download sequence
Identical sequences K9Q7Q8
gi|427706131|ref|YP_007048508.1| WP_015111598.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]