SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427706523|ref|YP_007048900.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427706523|ref|YP_007048900.1|
Domain Number 1 Region: 302-501
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 8.5e-50
Family Multidrug efflux transporter AcrB transmembrane domain 0.000024
Further Details:      
 
Domain Number 2 Region: 846-1041
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.57e-44
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000956
Further Details:      
 
Domain Number 3 Region: 40-132
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.92e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0014
Further Details:      
 
Domain Number 4 Region: 587-685
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.53e-19
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0045
Further Details:      
 
Domain Number 5 Region: 136-182,280-336
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.66e-19
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0081
Further Details:      
 
Domain Number 6 Region: 737-823
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.83e-18
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0019
Further Details:      
 
Domain Number 7 Region: 183-266
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000183
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0024
Further Details:      
 
Domain Number 8 Region: 695-736,823-870
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.000000000000837
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427706523|ref|YP_007048900.1|
Sequence length 1062
Comment acriflavin resistance protein [Nostoc sp. PCC 7107]
Sequence
MNISELFIRRPIMTTLVMVGVLIFGLMSYRMLPVSDLPNVDFPTIQVSANLPGANPETMA
ASVATPLEAQFSSIAGLSSMNSTSSLGSSQVTLQFDLSRDIDGAAQDVQAAIAKATRQLP
ADMPSPPSYRKVNPADQPILYISLNSAVLPLSTVDKYAETQLAQRLSMVNGVAQVQVYGS
QKYAVRVLLDPESLSAKGIGVDEVADAISKGNANIPTGTLYGQEQNFTIQANGQLNDAAA
YRSLIVSYQGGAPVQLGEVAQVLDSVENDKVASWYFSKTQKPKQKSHSGVRAIVLAIQKQ
PGTNTVEVVEAIKKLLPKFHEQIPAAVNMEILYDRSQAIRESVDDVQFTLLLTIGLVVLV
IFLFLRNLRATIIPSLAVPLSLVATLGVMLLLGFSLDNLSLMALTLSVGFVVDDAVVMLE
NIVRHMEMGESRLEAALNGSREIGFTILSMTISLVAVFIPVLFMGGILGRLFREFAVTIS
VAILVSGIISLSLTPMLCSRFLLPPHHQQADKGEPVKKGFKGRIQRFNRGLYNTSEKFFD
VILGGYEWSLKRSLKYHRTTMFISGAIVVATVYLFMVVPKGFIPTADVGQITASTQAAED
ISFAEMVKHQQAVAAIADRDPNIAAINSSVGAGGANSSSNTGRLFISLKPREERKLSADE
IVQELRPKLSRIPGMKVFLQNPPAINIGGQQSKAQYQFTLQSPNIQDLYQYAPTLEEKLR
GLPDLQDVNSDLQIKNPQVQVDINRDQAASMGLTAEQIETALSNAYGTRQVSTIYASDSQ
YQVIMGVEPKYQGDPSALELLSIHSPNGQLVPLNAVASISKGVGPLTINHSGQLASVTIS
FNLKPGVSLGSVTDKIEHIARQTLPASITTGFQGSAQAFQSSLQGLGLLLLVAILVIYIV
LGILYENFIHPLTILSSLPSAGFGALLSLLLFQVDLNIYAFVGIILLIGIVKKNGIMMVD
FAIEARQSGKTPYGAIYEACVVRFRPIMMTTMAALMGTLPIALGLGAGGDTRRPLGLAVV
GGLLFSQFLTLYLTPVFYTYMESWQSLMKKRQWRKQPDSHAV
Download sequence
Identical sequences K9Q7U6
WP_015111984.1.60169 gi|427706523|ref|YP_007048900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]