SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427706724|ref|YP_007049101.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427706724|ref|YP_007049101.1|
Domain Number 1 Region: 16-257
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000000353
Family PP2C-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427706724|ref|YP_007049101.1|
Sequence length 260
Comment hypothetical protein Nos7107_1302 [Nostoc sp. PCC 7107]
Sequence
MNTSKQIDHWRVVAASVCGTSHTRNKQLCQDAHNWQLLPDNILVAAAADGAGSASQGKIG
AMVATEAAVEHLSIKEVSRAFLADDLVVQSLLSDALLAAKKAVETEAAACNQQPQDLATT
LIITIATPEMVAAAQIGDGMAVAKNRQGSLIALTIPNNGEYINETTFLTSLDAIDTAQMR
LWREEIVNVGILTDGLQMLALNMVVGEPHKPFFFPLFDFIENAEDKTLAKEQLVRFLSSD
RITQRTDDDLTLIIAAFNRT
Download sequence
Identical sequences K9Q9Z2
WP_015112179.1.60169 gi|427706724|ref|YP_007049101.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]