SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427706742|ref|YP_007049119.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427706742|ref|YP_007049119.1|
Domain Number 1 Region: 48-273
Classification Level Classification E-value
Superfamily Caspase-like 2.09e-55
Family Caspase catalytic domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|427706742|ref|YP_007049119.1|
Domain Number - Region: 392-479
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 0.00157
Family Leukotriene A4 hydrolase N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427706742|ref|YP_007049119.1|
Sequence length 509
Comment peptidase C14 caspase catalytic subunit p20 [Nostoc sp. PCC 7107]
Sequence
MLWQKWQLLLGTAALLWPLTFSLTHPKIGESVAIAGKAIAQNPVLVQRQQRTALIIGNAN
YKLTDTLANPVNDATDIAKSLEQLGFKTILLKDANLRQMEEAIENFNRHLRQGGVGLFYF
AGHGIQVDGENYLIPVNARLKREQDVRYEAMPVGKVLNVMEDAANDANFIILDACRNNPF
ASRQWRSLQRGLAAPTQAVKGTLIAYATAPGKVALDGDGRNSPYTTALLRHMKTPSLDVE
QMFKQVRTEVLKTTGGKQTPWESSSLVGSFAFNQTNDSNRNNLITSVAKPQPSLNQPPVT
TSSPQITPAKINSSSIPSSRVTSPNEPPPTPAPSPRLTSPKDKLVHTPVPSALPNRISFV
QHPRLVEVVSTYNQVNTLGATYYFTIQVPKEAGTTLQKITINQHEGLDDINFQLKNIAAF
EGTRSEKGKKLSLRDISKDQNTRTVSITFDPPVNPGTQITIALYPEQNPQREGVYFFGVT
AFPTGEQSNGQFLDFGILHFYKNTGSLNS
Download sequence
Identical sequences K9QA47
gi|427706742|ref|YP_007049119.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]