SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427706843|ref|YP_007049220.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427706843|ref|YP_007049220.1|
Domain Number 1 Region: 156-453
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.21e-86
Family NadC C-terminal domain-like 0.0000302
Further Details:      
 
Domain Number 2 Region: 20-155
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 3.53e-41
Family NadC N-terminal domain-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427706843|ref|YP_007049220.1|
Sequence length 465
Comment nicotinate phosphoribosyltransferase [Nostoc sp. PCC 7107]
Sequence
MATIPDLGSYQHQDLTISAVDYSLLTDLYQLTMAACYVGEGLEQKQASFELFVRRSPENF
GYLIAMGLEQALAYLETLSFTQAQIAALQATGIFAHAGDRFWSLLAEGKFTGDVWAVPEG
TAVFANEPFLRIEAPLWQAQLIETYLLNTLNYQTLIATRAARLRDVAGEKAKLLEFGTRR
AFSPQGALWAARAALAGGLDATSNVLAALQLGQQPSGTMAHALVMALSAMEGSEAEAFTA
FHRYFPGAPLLIDTYDTIAAAEQLAIKVNSGEMELSGVRLDSGDLVSLSQQVRSLLPNVP
IVASGDLDEWEIARLKAAGAVIDGYGLGTRLVTGTPVNGVYKLVDIDGIPVMKQSSGKAT
YPGRKQIFRSFVDGKVKADRLGLITETPLSETPLLQLVMKAGQRVQFPESLAEIRQRTAA
TVASLPEETRRLTNPVALQVEISAGLQKLTEETGKRTAEAQRTQR
Download sequence
Identical sequences K9Q8T7
gi|427706843|ref|YP_007049220.1| WP_015112296.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]