SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427706890|ref|YP_007049267.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427706890|ref|YP_007049267.1|
Domain Number 1 Region: 6-224
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.75e-32
Family Nitrogenase iron protein-like 0.022
Further Details:      
 
Domain Number 2 Region: 213-329
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 1.7e-31
Family DRTGG domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427706890|ref|YP_007049267.1|
Sequence length 364
Comment DRTGG domain-containing protein [Nostoc sp. PCC 7107]
Sequence
MPKSAKHLLIGSTETYSGKSATVLGLSYQLQQKGLDIAYGKPLGTCLRTSGGTIVEEDVQ
FIASSLNLAANRIAPTMLALDEVSVQKRLSGEDNNNYRQLLVQQYLQVARGDLVLLEGPG
NLTEGHLFDLSTLQVAEELDAAVLLVTRYNSLLSLDALLAARERVGDRLVGVVLNDIPAK
ELEIVKNLVSPFLEQQGIAVLGTLPKNDLLRSVSVGELVNQLKAEVLCRSDRLDLMVESL
AIGAMNVNAAVKYFRKRRNMAVVTGGDRVEIQQAALETSTQCLILTGQLPPPQFILSRAE
ELEIPILSVDLDTLTTVEIVDRTFGQVRVHEPIKVQCIRQLMNEHFDIERLLLKLGLSPA
ATLS
Download sequence
Identical sequences K9QBB3
WP_015112343.1.60169 gi|427706890|ref|YP_007049267.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]