SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427707203|ref|YP_007049580.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427707203|ref|YP_007049580.1|
Domain Number 1 Region: 125-303
Classification Level Classification E-value
Superfamily E set domains 1.49e-64
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000706
Further Details:      
 
Domain Number 2 Region: 39-161
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.16e-21
Family Voltage-gated potassium channels 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427707203|ref|YP_007049580.1|
Sequence length 304
Comment Ion transport 2 domain-containing protein [Nostoc sp. PCC 7107]
Sequence
MKFQLKRLARKQRQRPQPIIHLKYHNGNVEIMGLGVWHSYWRDPYHLLLTVSWSGFVLLI
CAFYVIINTLFALAYLLGGDCITNARPGSFVDAFFFSVQTLASIGYGAMYPKTTYANIIV
TVEAIVGVMGIAVMTGLAFARFSRPTARVIFSRVAVIVPYDGAPTLMFRTANQRRNLILE
AQMRVYLMRDEVTAEGDFMRRIYDLKLLRQQTPGFTLTWSVMHVIDQSSPLYGMTPESLS
QTNCVLMVSLSGIDETVAQIVHARHSYGSNEILWNHRFVDILHHASNGHRYIDYNHFHDV
LPLE
Download sequence
Identical sequences K9Q9U3
WP_015112650.1.60169 gi|427707203|ref|YP_007049580.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]