SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427707350|ref|YP_007049727.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427707350|ref|YP_007049727.1|
Domain Number 1 Region: 806-910
Classification Level Classification E-value
Superfamily CalX-like 4.32e-27
Family CalX-beta domain 0.001
Further Details:      
 
Domain Number 2 Region: 1009-1163
Classification Level Classification E-value
Superfamily beta-Roll 1.26e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.00035
Further Details:      
 
Domain Number 3 Region: 560-680
Classification Level Classification E-value
Superfamily CalX-like 7.59e-21
Family CalX-beta domain 0.0018
Further Details:      
 
Domain Number 4 Region: 678-798
Classification Level Classification E-value
Superfamily CalX-like 3.14e-19
Family CalX-beta domain 0.0032
Further Details:      
 
Domain Number 5 Region: 255-391
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000213
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.034
Further Details:      
 
Weak hits

Sequence:  gi|427707350|ref|YP_007049727.1|
Domain Number - Region: 429-524
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0017
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427707350|ref|YP_007049727.1|
Sequence length 1188
Comment Na-Ca exchanger/integrin-beta4 [Nostoc sp. PCC 7107]
Sequence
MSNTLNLTGSLIYNQLSNFSGLKNFWNLFDTVFGTEYDHTVAAKLHSQWQSGDFSQFPKI
EIISNSIFEDTHTGYVSSSNKIYLLDSLIATATPTAIKAVLLKEIGNFIHGVIQPTNISG
DKGAIFADLVLSNSSTNPAPAPTSILQPTLIQALQSSKAHAQRCSCSSCMLAPVNFNLVS
AQTSQLPQTASATLDLSKTFSLNSLAGANQTIYLDFNGHTTSGTYWNTDFKSGANIVTPA
FDFDGNTASFSSAELERIQYIWQRVAEDFSPFNVNITTQAPTDINDLIRSGSTDTRWGVR
VVVGGSSYDLLGDGAGGVAYLDSFNWNNDTPAYVFSKNLQNSEKYTAEAISHEVGHTLGL
SHDGRINPAEGYYNGHGSGVTGWAGIMGAGYYQNLTQWSKGEYASANNTEDDLQIITTYN
GFSYRTDDAGNTITTAKSLAISGTSVTGSGIIERNTDVDFYSFVTGAGAINLTVDPFSRG
PNLDILAKLYNSAGTLIASSNPTDLLSAAIATTVTAGTYYLAIDGVGKGDILSTGYTDYG
SLGQYFISGSIVSSSTIPSNPTVSLALSSTSVDEDGSSNLIYTFTRSGSTTNTLKVNYSV
GGTATFNSDYRQLGATSFTATTGTITFAAGASTATLTIDPTADTTFETNETVVLTLANGS
GYTIGTTTAVTATIVNDDLPTITLSVSSSSVNEDGSSNLIYTFTRSGSNINALTVNYGVS
GTATFNSDYSQLGAASFTATNGTITFAAGASTATLNIDPTADTTFETNENVTLTLAAGSG
YKIGTTTGITRSIVNDDLRPTINLSSSQTIIEGNTNPQNVTYLVTLSNASSQTITVYYST
VNASATAGSDYTATAGTLTFNPGVTSQVINIPILNDSLNEADESFILSLKSPTNATLSTT
TSVTTTITDTLVTSVTTNLPTNVENLTLTGTAAINGTGNAGNNILTGNSGNNTLTGEDGN
DTYLLSAITPLGTDRIVETTTGGIDTIDFRGTTISSNLNLGITTTQTVNNNLNLIFSANN
VIENATGGIGNDAITGNALNNILTGGNGNDQLQGLAGDDTLWGGLDDDILTGGVGKDKYL
FQADGVFSTNLGIDHITDFEGGQDQIVLSKSTFKAITNSAGQTLTDFAVVTDDQFVNASS
KRIVYSQSTGSLFYNQDGNVLGTGTVFEFARLGNSSITLTGSDFSLIV
Download sequence
Identical sequences K9QCL7
gi|427707350|ref|YP_007049727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]